LRFN2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRFN2 Antibody [NBP2-57321] - Staining of human cell line SH-SY5Y shows localization to vesicles.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LRFN2 Antibody [NBP2-57321] - Staining in human cerebral cortex and liver tissues using anti-LRFN2 antibody. Corresponding LRFN2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: LRFN2 Antibody [NBP2-57321] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: LRFN2 Antibody [NBP2-57321] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LRFN2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('PWRIPPSAPRPKPSLDRLMGAFASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLL',)
Specificity
Specificity of human LRFN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRFN2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRFN2 Recombinant Protein Antigen (NBP2-57321PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LRFN2 Antibody

  • fibronectin type III, immunoglobulin and leucine rich repeat domains 2
  • FIGLER2
  • KIAA1246
  • leucine rich repeat and fibronectin type III domain containing 2
  • LRFN2
  • SALM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77004
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
MAB5669
Species: Hu
Applications: IHC
NBP2-67394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5445
Species: Hu
Applications: IHC
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82267
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-00858
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003996-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-19516
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00004745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-57321
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for LRFN2 Antibody (NBP2-57321) (0)

There are no publications for LRFN2 Antibody (NBP2-57321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRFN2 Antibody (NBP2-57321) (0)

There are no reviews for LRFN2 Antibody (NBP2-57321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRFN2 Antibody (NBP2-57321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRFN2 Products

Array NBP2-57321

Bioinformatics Tool for LRFN2 Antibody (NBP2-57321)

Discover related pathways, diseases and genes to LRFN2 Antibody (NBP2-57321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRFN2 Antibody (NBP2-57321)

Discover more about diseases related to LRFN2 Antibody (NBP2-57321).
 

Pathways for LRFN2 Antibody (NBP2-57321)

View related products by pathway.

Blogs on LRFN2

There are no specific blogs for LRFN2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRFN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRFN2