PHACTR4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PHACTR4 Antibody [NBP1-82267] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHACTR4 Antibody [NBP1-82267] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHACTR4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE
Specificity
Specificity of human, mouse PHACTR4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHACTR4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence was reported in scientific literature. Use in Immunoprecipitation and western blot reported in scientific literature (PMID 24748504)
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PHACTR4 Protein (NBP1-82267PEP)
Publications
Read Publications using
NBP1-82267 in the following applications:

  • 2 publications
  • IHC
    1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23319639). Mouse reactivity reported in scientific literature (PMID: 22766235). Rat (80%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHACTR4 Antibody

  • DKFZp686L07205
  • FLJ13171
  • MGC20618
  • MGC34186
  • phosphatase and actin regulator 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NLS1071
Species: Hu
Applications: IHC-P
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
AF7109
Species: Mu
Applications: WB, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-85919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF753
Species: Mu
Applications: WB, IHC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90495
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4524
Species: Rt
Applications: WB
NBP2-57321
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6379
Species: Hu
Applications: WB
NBP1-86460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32414
Species: Hu
Applications: IHC, IHC-P
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready

Publications for PHACTR4 Antibody (NBP1-82267)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 4 applications: ICC/IF, IHC, IP, WB.


Filter By Application
ICC/IF
(2)
IHC
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for PHACTR4 Antibody (NBP1-82267) (0)

There are no reviews for PHACTR4 Antibody (NBP1-82267). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHACTR4 Antibody (NBP1-82267) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PHACTR4 Antibody (NBP1-82267)

Discover related pathways, diseases and genes to PHACTR4 Antibody (NBP1-82267). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHACTR4 Antibody (NBP1-82267)

Discover more about diseases related to PHACTR4 Antibody (NBP1-82267).
 

Pathways for PHACTR4 Antibody (NBP1-82267)

View related products by pathway.

PTMs for PHACTR4 Antibody (NBP1-82267)

Learn more about PTMs related to PHACTR4 Antibody (NBP1-82267).

Blogs on PHACTR4

There are no specific blogs for PHACTR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHACTR4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHACTR4
Entrez
Uniprot