PHACTR4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PHACTR4 Antibody [NBP1-82267] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PHACTR4 Antibody [NBP1-82267] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHACTR4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHACTR4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation/Permeabilization: PFA/Triton X-100
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  PHACTR4 Protein (NBP1-82267PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24748504). Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHACTR4 Antibody - BSA Free

• DKFZp686L07205
• FLJ13171
• MGC20618
• MGC34186
• phosphatase and actin regulator 4

Background

PHACTR4 encodes a member of the phosphatase and actin regulator (PHACTR) family. Other PHACTR family members have been shown to inhibit protein phosphatase 1 (PP1) activity, and the homolog of this gene in the mouse has been shown to interact with actin and PP1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHACTR4 Antibody (NBP1-82267)(3)

Publications using NBP1-82267

• Cho HM, Kim JY, Kim H et al. Phosphatase and actin regulator 4 is associated with intermediate filaments in adult neural stem cells and their progenitor astrocytes. Histochem. Cell Biol. 2014-04-20 [PMID: 24748504] (ICC/IF, WB, IP, Mouse)
• Solimini NL, Liang AC, Xu C et al. STOP gene Phactr4 is a tumor suppressor. Proc Natl Acad Sci U S A 2013-01-29 [PMID: 23319639]
• JY Kim, SY Choi, Y Moon, HJ et al. Different expression patterns of Phactr family members in normal and injured mouse brain Neuroscience 2012 [PMID: 22766235] (IHC, ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: PHACTR4
• Entrez:
  • 65979(Human)
• Uniprot:
  • Q8IZ21(Human)