LRCH4 Antibody

Images

 
Western Blot: LRCH4 Antibody [NBP1-69265] - This Anti-LRCH4 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRCH4 Antibody Summary

Immunogen
Synthetic peptides corresponding to LRCH4(leucine-rich repeats and calponin homology (CH) domain containing 4) The peptide sequence was selected from the middle region of LRCH4. Peptide sequence PGHRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRISELAR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRCH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LRCH4 and was validated on Western blot.
Theoretical MW
73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRCH4 Antibody

  • FLJ40101
  • FLJ46315
  • leucine rich repeat neuronal 4
  • Leucine-rich neuronal protein
  • leucine-rich repeat and calponin homology domain-containing protein 4
  • Leucine-rich repeat neuronal protein 4
  • leucine-rich repeats and calponin homology (CH) domain containing 4
  • LRN
  • LRRN1
  • LRRN4
  • PP14183

Background

LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.This gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded protein resembles a receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF1936
Species: Hu
Applications: WB, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15412
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-56414
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-63270
Species: Hu
Applications: WB, ELISA
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69265
Species: Hu
Applications: WB

Publications for LRCH4 Antibody (NBP1-69265) (0)

There are no publications for LRCH4 Antibody (NBP1-69265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRCH4 Antibody (NBP1-69265) (0)

There are no reviews for LRCH4 Antibody (NBP1-69265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRCH4 Antibody (NBP1-69265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRCH4 Products

Bioinformatics Tool for LRCH4 Antibody (NBP1-69265)

Discover related pathways, diseases and genes to LRCH4 Antibody (NBP1-69265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRCH4

There are no specific blogs for LRCH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRCH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRCH4
Uniprot