LPAR2/LPA2/EDG-4 Antibody - Azide and BSA Free

Western Blot: LPAR2/LPA2/EDG-4 Antibody [NBP3-02981] - Analysis of extracts of HL-60 cells, using LPAR2/LPA2/EDG-4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LPAR2/LPA2/EDG-4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit LPAR2/LPA2/EDG-4 Antibody - Azide and BSA Free (NBP3-02981) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LPAR2/LPA2/EDG-4 (NP_004711.2). FVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPAR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500-1:2000
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for LPAR2/LPA2/EDG-4 Antibody - Azide and BSA Free

• EDG4
• EDG-4
• EDG4FLJ93869
• endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor4,LPA receptor EDG4
• G protein-coupled receptor
• LPA2
• LPA-2
• LPA2LPA receptor 2
• LPAR2
• lysophosphatidic acid receptor 2
• lysophosphatidic acid receptor EDG4
• Lysophosphatidic acid receptor Edg-4

Background

Edg4 is a Lysophospholipid/Lysosphingolipid Receptor activated by phosphatidic acid (PA) and lysophosphatidic acid (LPA). It enhances the transcription of serum response element (SRE) reporter genes. In CD4(+) T cells, Edg4 may be involved in the control of interleukin-2 secretion. Edg4 expression has been documented in leukocytes, pancreas, spleen, thymus, prostate, and testis. Edg4 expression has also been seen in many cancer cell lines, including those of brain, blood, breast, ovary, cervix, colon, skin, and thyroid. ESTs have been isolated from B-cell/lung/testis, blood, brain, embryo, heart/melanocyte/uterus, liver, placenta, prostate, and skin libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: LPAR2