LPAR2/LPA2/EDG-4 Antibody

Images

 
Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NBP1-84904] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LPAR2/LPA2/EDG-4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Specificity
Specificity of human LPAR2/LPA2/EDG-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPAR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
WB reported in scientific literature (PMID: 26418031). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP)
Publications
Read Publications using
NBP1-84904 in the following applications:

  • WB
    2 publications

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%). Human reactivity reported in scientific literature (PMID: 25002680).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LPAR2/LPA2/EDG-4 Antibody

  • EDG4
  • EDG-4
  • EDG4FLJ93869
  • endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor4,LPA receptor EDG4
  • G protein-coupled receptor
  • LPA2
  • LPA-2
  • LPA2LPA receptor 2
  • LPAR2
  • lysophosphatidic acid receptor 2
  • lysophosphatidic acid receptor EDG4
  • Lysophosphatidic acid receptor Edg-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03363
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84903
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NLS1895
Species: Hu, Mu, Rt, Bt, Ha, Pm, Pm
Applications: Flow, IHC, IHC-P
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP3-05160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-84904
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904) (0)

There are no reviews for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LPAR2/LPA2/EDG-4 Products

Bioinformatics Tool for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904)

Discover related pathways, diseases and genes to LPAR2/LPA2/EDG-4 Antibody (NBP1-84904). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904)

Discover more about diseases related to LPAR2/LPA2/EDG-4 Antibody (NBP1-84904).
 

Pathways for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904)

View related products by pathway.

Research Areas for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904)

Find related products by research area.

Blogs on LPAR2/LPA2/EDG-4

There are no specific blogs for LPAR2/LPA2/EDG-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LPAR2/LPA2/EDG-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPAR2