LPAR2/LPA2/EDG-4 Antibody - BSA Free

Western Blot: LPAR2/LPA2/EDG-4 Antibody [NBP1-84904] - Representative western blot and densitometric analysis of Caco-2, HT-29 and HCT-116 cells using specific antibodies against LPAR2/LPA2/EDG-4. Caco-2 cells express high levels of LPAR2/LPA2/EDG-4. The average scores +/- SEM is shown. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26418031/) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: LPAR2/LPA2/EDG-4 Antibody [NBP1-84904] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LPAR2/LPA2/EDG-4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LPAR2/LPA2/EDG-4 Antibody - BSA Free (NBP1-84904) is a polyclonal antibody validated for use in IHC and WB. Anti-LPAR2/LPA2/EDG-4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPAR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot Reported in scientific literature (PMID: 26418031).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LPAR2/LPA2/EDG-4 Antibody - BSA Free

• EDG4
• EDG-4
• EDG4FLJ93869
• endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor4,LPA receptor EDG4
• G protein-coupled receptor
• LPA2
• LPA-2
• LPA2LPA receptor 2
• LPAR2
• lysophosphatidic acid receptor 2
• lysophosphatidic acid receptor EDG4
• Lysophosphatidic acid receptor Edg-4

Background

Edg4 is a Lysophospholipid/Lysosphingolipid Receptor activated by phosphatidic acid (PA) and lysophosphatidic acid (LPA). It enhances the transcription of serum response element (SRE) reporter genes. In CD4(+) T cells, Edg4 may be involved in the control of interleukin-2 secretion. Edg4 expression has been documented in leukocytes, pancreas, spleen, thymus, prostate, and testis. Edg4 expression has also been seen in many cancer cell lines, including those of brain, blood, breast, ovary, cervix, colon, skin, and thyroid. ESTs have been isolated from B-cell/lung/testis, blood, brain, embryo, heart/melanocyte/uterus, liver, placenta, prostate, and skin libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LPAR2/LPA2/EDG-4 Antibody (NBP1-84904)(2)

Publications using NBP1-84904

• Leve F, Peres-Moreira RJ, Binato R et al. LPA Induces Colon Cancer Cell Proliferation through a Cooperation between the ROCK and STAT-3 Pathways. PLoS One 2015-01-01 [PMID: 26418031] (WB, Human)
• Kuriyama S, Theveneau E, Benedetto A et al. In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity. J Cell Biol 2014-07-07 [PMID: 25002680] (WB, Human)

Bioinformatics

• Gene Symbol: LPAR2