LOXL4 Antibody


Western Blot: LOXL4 Antibody [NBP1-74257] - Titration: 1.0 ug/ml Positive Control: Fetal Heart.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LOXL4 Antibody Summary

Synthetic peptides corresponding to the middle region of LOXL4. Immunizing peptide sequence ARGKLRPACPGGMHAVVSCVAGPHFRPPKTKPQRKGSWAEEPRVRLRSGA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LOXL4 and was validated on Western blot.
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LOXL4 Antibody

  • EC 1.4.3
  • EC 1.4.3.-
  • FLJ21889
  • LOXClysyl oxidase related C
  • lysyl oxidase homolog 4
  • lysyl oxidase-like 4
  • Lysyl oxidase-like protein 4
  • Lysyl oxidase-related protein C


This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Species: Hu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for LOXL4 Antibody (NBP1-74257) (0)

There are no publications for LOXL4 Antibody (NBP1-74257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LOXL4 Antibody (NBP1-74257) (0)

There are no reviews for LOXL4 Antibody (NBP1-74257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LOXL4 Antibody (NBP1-74257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for LOXL4 Antibody (NBP1-74257)

Discover related pathways, diseases and genes to LOXL4 Antibody (NBP1-74257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LOXL4 Antibody (NBP1-74257)

Discover more about diseases related to LOXL4 Antibody (NBP1-74257).

Pathways for LOXL4 Antibody (NBP1-74257)

View related products by pathway.

PTMs for LOXL4 Antibody (NBP1-74257)

Learn more about PTMs related to LOXL4 Antibody (NBP1-74257).

Research Areas for LOXL4 Antibody (NBP1-74257)

Find related products by research area.

Blogs on LOXL4

There are no specific blogs for LOXL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LOXL4 Antibody and receive a gift card or discount.


Gene Symbol LOXL4