LMX1b Recombinant Protein Antigen

Images

 
There are currently no images for LMX1b Recombinant Protein Antigen (NBP2-58009PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LMX1b Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMX1b.

Source: E.coli

Amino Acid Sequence: DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
LMX1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58009 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMX1b Recombinant Protein Antigen

  • LIM homeobox transcription factor 1, beta
  • LIM homeobox transcription factor 1-beta
  • LIM/homeobox protein 1.2
  • LIM/homeobox protein LMX1B
  • LMX1.2
  • LMX-1.2
  • MGC138325
  • MGC142051
  • NPS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
423-F8/CF
Species: Hu, Mu
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41193
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF3364
Species: Hu
Applications: WB, ICC
AF1620
Species: Mu
Applications: WB, IHC
AF3159
Species: Mu
Applications: WB, IHC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
AF2567
Species: Mu
Applications: WB, IHC
3008-WN/CF
Species: Hu
AF1979
Species: Hu
Applications: WB, Simple Western, ICC

Publications for LMX1b Recombinant Protein Antigen (NBP2-58009PEP) (0)

There are no publications for LMX1b Recombinant Protein Antigen (NBP2-58009PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMX1b Recombinant Protein Antigen (NBP2-58009PEP) (0)

There are no reviews for LMX1b Recombinant Protein Antigen (NBP2-58009PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for LMX1b Recombinant Protein Antigen (NBP2-58009PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMX1b Products

Bioinformatics Tool for LMX1b Recombinant Protein Antigen (NBP2-58009PEP)

Discover related pathways, diseases and genes to LMX1b Recombinant Protein Antigen (NBP2-58009PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMX1b Recombinant Protein Antigen (NBP2-58009PEP)

Discover more about diseases related to LMX1b Recombinant Protein Antigen (NBP2-58009PEP).
 

Pathways for LMX1b Recombinant Protein Antigen (NBP2-58009PEP)

View related products by pathway.

Research Areas for LMX1b Recombinant Protein Antigen (NBP2-58009PEP)

Find related products by research area.

Blogs on LMX1b

There are no specific blogs for LMX1b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LMX1b Antibody
NBP2-41194
LMX1b Antibody
NBP2-41194
LMX1b Antibody
NBP2-41194

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMX1b Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LMX1B