LMX1b Recombinant Protein Antigen

Images

 
There are currently no images for LMX1b Recombinant Protein Antigen (NBP2-58009PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LMX1b Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMX1b.

Source: E. coli

Amino Acid Sequence: DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LMX1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58009.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMX1b Recombinant Protein Antigen

  • LIM homeobox transcription factor 1, beta
  • LIM homeobox transcription factor 1-beta
  • LIM/homeobox protein 1.2
  • LIM/homeobox protein LMX1B
  • LMX1.2
  • LMX-1.2
  • MGC138325
  • MGC142051
  • NPS1

Background

LMX1B is a gene that codes for a protein with three isoforms, measuring 402, 395, and 406 amino acids in length with weights of approximately 45, 44, and 45 kDa respectively. LMX1B is necessary for the specification of dorsal limb fate. Current studies are being done on several diseases and disorders related to this gene including Meier-Gorlin syndrome, steroid-resistant nephrotic syndrome, sex reversal, attention deficit hyperactivity disorder, cleft lip/palate, familial Mediterranean fever, genitopatellar syndrome, major depressive disorder, nail dysplasia, short stature, heart block, and neuronitis. LMX1B has also been shown to have interactions with LDB1, TCF3, SSBP3, ALX4, and LDB2 in pathways such as the SIDS susceptibility pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-85481
Species: Hu
Applications: IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41193
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
H00002019-M04
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP3-47310
Species: Hu
Applications: ELISA, IHC
NBP3-23927
Species: Hu
Applications: IHC-P
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF3364
Species: Hu
Applications: ICC, IHC, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3159
Species: Mu
Applications: IHC
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF2567
Species: Mu
Applications: IHC, WB
NBP2-20913
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF1979
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-58009PEP
Species: Hu
Applications: AC

Publications for LMX1b Recombinant Protein Antigen (NBP2-58009PEP) (0)

There are no publications for LMX1b Recombinant Protein Antigen (NBP2-58009PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMX1b Recombinant Protein Antigen (NBP2-58009PEP) (0)

There are no reviews for LMX1b Recombinant Protein Antigen (NBP2-58009PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LMX1b Recombinant Protein Antigen (NBP2-58009PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMX1b Products

Array NBP2-58009PEP

Research Areas for LMX1b Recombinant Protein Antigen (NBP2-58009PEP)

Find related products by research area.

Blogs on LMX1b

There are no specific blogs for LMX1b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMX1b Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LMX1B