Recombinant Human LMW-PTP/ACP1 Protein

Product Discontinued

Recombinant Human LMW-PTP/ACP1 Protein Summary

• Description: A full-length recombinant protein with His tag corresponding to the amino acids 1 - 158 of Human ACP1
  
  

  Source: Escherichia coli

  Amino Acid Sequence:MGSSHHHHHHSSGLVPRGSHMAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

• Preparation Method: Escherichia coli expression system
• Details of Functionality: Activity tested: > 60,000 unit/mg of protein
• Protein/Peptide Type: Recombinant Protein
• Gene: ACP1

Applications/Dilutions

• Dilutions:
  • Functional
  • SDS-Page
• Application Notes: This product is useful for and SDS-PAGE and Functional assays.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: In 20 mM MES 6.0, 0.1 mM PMSF, 2 mM EDTA (10% glycerol)
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LMW-PTP/ACP1 Protein

• acid phosphatase 1, soluble
• acid phosphatase of erythrocyte
• ACP1
• Adipocyte acid phosphatase
• cytoplasmic phosphotyrosyl protein phosphatase
• EC 3.1.3.2
• EC 3.1.3.48
• HAAP
• LMWPTP
• LMW-PTP
• LMW-PTPase
• Low molecular weight cytosolic acid phosphatase
• low molecular weight phosphotyrosine protein phosphatase
• MGC111030
• MGC3499
• protein tyrosine phosphatase
• Red cell acid phosphatase 1

Background

The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Three transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACP1