LMW-PTP/ACP1 Antibody (4B10)

Images

 
Western Blot: LMW-PTP/ACP1 Antibody (4B10) [H00000052-M01] - ACP1 monoclonal antibody (M01), clone 4B10. Analysis of ACP1 expression in NIH/3T3.
Western Blot: LMW-PTP/ACP1 Antibody (4B10) [H00000052-M01] - ACP1 monoclonal antibody (M01), clone 4B10. Analysis of ACP1 expression in HeLa.
Western Blot: LMW-PTP/ACP1 Antibody (4B10) [H00000052-M01] - ACP1 monoclonal antibody (M01), clone 4B10. Analysis of ACP1 expression in PC-12.
Western Blot: LMW-PTP/ACP1 Antibody (4B10) [H00000052-M01] - ACP1 monoclonal antibody (M01), clone 4B10. Analysis of ACP1 expression in Raw 264.7.
Western Blot: LMW-PTP/ACP1 Antibody (4B10) [H00000052-M01] - Analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody (M01), clone 4B10.Lane 1: ACP1 transfected lysate(18 KDa).Lane 2: ...read more
Sandwich ELISA: LMW-PTP/ACP1 Antibody (4B10) [H00000052-M01] - Detection limit for recombinant GST tagged ACP1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
4B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LMW-PTP/ACP1 Antibody (4B10) Summary

Immunogen
ACP1 (AAH07422, 1 a.a. - 158 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Specificity
ACP1 (4B10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMW-PTP/ACP1 Antibody (4B10)

  • acid phosphatase 1, soluble
  • acid phosphatase of erythrocyte
  • ACP1
  • Adipocyte acid phosphatase
  • cytoplasmic phosphotyrosyl protein phosphatase
  • EC 3.1.3.2
  • EC 3.1.3.48
  • HAAP
  • LMWPTP
  • LMW-PTP
  • LMW-PTPase
  • Low molecular weight cytosolic acid phosphatase
  • low molecular weight phosphotyrosine protein phosphatase
  • MGC111030
  • MGC3499
  • protein tyrosine phosphatase
  • Red cell acid phosphatase 1

Background

The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Three transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for LMW-PTP/ACP1 Antibody (H00000052-M01) (0)

There are no publications for LMW-PTP/ACP1 Antibody (H00000052-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMW-PTP/ACP1 Antibody (H00000052-M01) (0)

There are no reviews for LMW-PTP/ACP1 Antibody (H00000052-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMW-PTP/ACP1 Antibody (H00000052-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMW-PTP/ACP1 Products

Bioinformatics Tool for LMW-PTP/ACP1 Antibody (H00000052-M01)

Discover related pathways, diseases and genes to LMW-PTP/ACP1 Antibody (H00000052-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMW-PTP/ACP1 Antibody (H00000052-M01)

Discover more about diseases related to LMW-PTP/ACP1 Antibody (H00000052-M01).
 

Pathways for LMW-PTP/ACP1 Antibody (H00000052-M01)

View related products by pathway.

PTMs for LMW-PTP/ACP1 Antibody (H00000052-M01)

Learn more about PTMs related to LMW-PTP/ACP1 Antibody (H00000052-M01).
 

Research Areas for LMW-PTP/ACP1 Antibody (H00000052-M01)

Find related products by research area.

Blogs on LMW-PTP/ACP1

There are no specific blogs for LMW-PTP/ACP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMW-PTP/ACP1 Antibody (4B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACP1
Entrez
OMIM
Uniprot