LMOD1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit LMOD1 Antibody - BSA Free (NBP1-89398) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQMPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LMOD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LMOD1 Antibody - BSA Free
Background
LMOD1, also known as Leiomodin-1, has a 600 amino acid long isoform that is 67 kDa and a short 572 amino acid that is 64 kDa, belongs to the tropomodulin family, most commonly found in smooth muscle (heart, skeletal muscle, colon and small intestine), and has a putative membrane-spanning region and 2 types of tandemly repeated blocks. Current research is being performed on several diseases and disorders including thyroiditis, autoimmune thyroiditis, eye disease, graves' disease, hyperthyroidism, goiter, adenoma, breast cancer, retinoblastoma, carcinoma, thyroid hormone metabolism, mccune albright syndrome, bullous pemphigoid thyrotoxicosis, papillary thyroid carcinoma, coronary restenosis, follicular thyroid carcinoma, iodine deficiency, systemic lupus erythematosus, and pituitary adenom Interactions with this protein have been shown to involve ACTB, MYH11, TLN1, TPM1 and VCL proteins in smooth muscle contraction and muscle contraction pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for LMOD1 Antibody (NBP1-89398) (0)
There are no publications for LMOD1 Antibody (NBP1-89398).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LMOD1 Antibody (NBP1-89398) (0)
There are no reviews for LMOD1 Antibody (NBP1-89398).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for LMOD1 Antibody (NBP1-89398) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LMOD1 Products
Research Areas for LMOD1 Antibody (NBP1-89398)
Find related products by research area.
|
Blogs on LMOD1