LMCD1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: LMCD1 Antibody [NBP1-85986] - Staining in human skeletal muscle and liver tissues using anti-LMCD1 antibody. Corresponding LMCD1 RNA-seq data are presented ...read more
Orthogonal Strategies: Western Blot: LMCD1 Antibody [NBP1-85986] - Analysis in human cell lines A-549 and HeLa using Anti-LMCD1 antibody. Corresponding LMCD1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: LMCD1 Antibody [NBP1-85986] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMCD1 Antibody [NBP1-85986] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: LMCD1 Antibody [NBP1-85986] - Staining of human skeletal muscle shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LMCD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGA
Specificity
Specificity of human LMCD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LMCD1 Protein (NBP1-85986PEP)
Publications
Read Publication using NBP1-85986.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22253135)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMCD1 Antibody

  • dyxin
  • LIM and cysteine-rich domains 1
  • LIM and cysteine-rich domains protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85816
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
NB100-77341
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-87987
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-62583
Species: Hu
Applications: WB
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-85986
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LMCD1 Antibody (NBP1-85986)(1)

Reviews for LMCD1 Antibody (NBP1-85986) (0)

There are no reviews for LMCD1 Antibody (NBP1-85986). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMCD1 Antibody (NBP1-85986) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LMCD1 Products

Bioinformatics Tool for LMCD1 Antibody (NBP1-85986)

Discover related pathways, diseases and genes to LMCD1 Antibody (NBP1-85986). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMCD1 Antibody (NBP1-85986)

Discover more about diseases related to LMCD1 Antibody (NBP1-85986).
 

Pathways for LMCD1 Antibody (NBP1-85986)

View related products by pathway.

PTMs for LMCD1 Antibody (NBP1-85986)

Learn more about PTMs related to LMCD1 Antibody (NBP1-85986).

Blogs on LMCD1

There are no specific blogs for LMCD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMCD1