LMCD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LMCD1 Antibody [NBP1-85986] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LMCD1 Antibody [NBP1-85986] - Staining in human skeletal muscle and liver tissues using anti-LMCD1 antibody. Corresponding LMCD1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LMCD1 Antibody [NBP1-85986] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: LMCD1 Antibody [NBP1-85986] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and nuclear positivity in molecular layer cells.

Immunohistochemistry-Paraffin: LMCD1 Antibody [NBP1-85986] -Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Analysis in human cell lines A-549 and HeLa using Anti-LMCD1 antibody. Corresponding LMCD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LMCD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LMCD1 Antibody - BSA Free (NBP1-85986) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LMCD1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGA
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LMCD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LMCD1 Protein (NBP1-85986PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LMCD1 Antibody - BSA Free

• dyxin
• LIM and cysteine-rich domains 1
• LIM and cysteine-rich domains protein 1

Background

The protein encoded by the LMCD1 gene contains a cysteine-rich domain in the N-terminal region and 2 LIM domains in the C-terminal region. It also has several potential phosphorylation and N-myristoylation sites and a single potential N-glycosylation site. The presence of LIM domains implies involvement in protein-protein interactions. Expression of this gene has been detected in most tissues, with highest expression in skeletal muscle. Transcript variants utilizing alternative polyA signals have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LMCD1 Antibody (NBP1-85986)(1)

Publication using NBP1-85986

• Li A, Ponten F, dos Remedios CG. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics 2012-01-01 [PMID: 22253135]

Bioinformatics

• Gene Symbol: LMCD1