LITAF Recombinant Protein Antigen

Images

 
There are currently no images for LITAF Protein (NBP1-83473PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LITAF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LITAF.

Source: E. coli

Amino Acid Sequence: APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LITAF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83473.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LITAF Recombinant Protein Antigen

  • CMT1C
  • FLJ38636
  • lipopolysaccharide-induced TNF factor
  • lipopolysaccharide-induced TNF-alpha factor
  • lipopolysaccharide-induced tumor necrosis factor-alpha factor
  • LITAF
  • LPS-induced TNF-alpha factor
  • MGC116698
  • MGC116700
  • MGC125275
  • MGC125276
  • p53-induced gene 7 protein
  • PIG7
  • PIG7MGC116701
  • SIMPLE
  • SIMPLEMGC125274
  • Small integral membrane protein of lysosome/late endosome
  • TP53I7
  • tumor protein p53 inducible protein 7

Background

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP2-80913
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-46842
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
DY417
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
H00008898-M03
Species: Hu, Rt
Applications: ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
NBP1-84430
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13283
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-47477
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NB300-131
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83473PEP
Species: Hu
Applications: AC

Publications for LITAF Protein (NBP1-83473PEP) (0)

There are no publications for LITAF Protein (NBP1-83473PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LITAF Protein (NBP1-83473PEP) (0)

There are no reviews for LITAF Protein (NBP1-83473PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LITAF Protein (NBP1-83473PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LITAF Products

Research Areas for LITAF Protein (NBP1-83473PEP)

Find related products by research area.

Blogs on LITAF

There are no specific blogs for LITAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LITAF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LITAF