LITAF Antibody (2E12)

Images

 
Sandwich ELISA: LITAF Antibody (2E12) [H00009516-M01] - Detection limit for recombinant GST tagged LITAF is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LITAF Antibody (2E12) Summary

Immunogen
LITAF (NP_004853.2, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LITAF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is useful for ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LITAF Antibody (2E12)

  • CMT1C
  • FLJ38636
  • lipopolysaccharide-induced TNF factor
  • lipopolysaccharide-induced TNF-alpha factor
  • lipopolysaccharide-induced tumor necrosis factor-alpha factor
  • LITAF
  • LPS-induced TNF-alpha factor
  • MGC116698
  • MGC116700
  • MGC125275
  • MGC125276
  • p53-induced gene 7 protein
  • PIG7
  • PIG7MGC116701
  • SIMPLE
  • SIMPLEMGC125274
  • Small integral membrane protein of lysosome/late endosome
  • TP53I7
  • tumor protein p53 inducible protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NB110-59086
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBL1-15012
Species: Hu
Applications: WB
DY417
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
H00008898-M03
Species: Hu, Rt
Applications: ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-66383
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84430
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13283
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP2-47477
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NB300-131
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009516-M01
Species: Hu
Applications: ELISA, S-ELISA

Publications for LITAF Antibody (H00009516-M01) (0)

There are no publications for LITAF Antibody (H00009516-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LITAF Antibody (H00009516-M01) (0)

There are no reviews for LITAF Antibody (H00009516-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LITAF Antibody (H00009516-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LITAF Products

Bioinformatics Tool for LITAF Antibody (H00009516-M01)

Discover related pathways, diseases and genes to LITAF Antibody (H00009516-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LITAF Antibody (H00009516-M01)

Discover more about diseases related to LITAF Antibody (H00009516-M01).
 

Pathways for LITAF Antibody (H00009516-M01)

View related products by pathway.

PTMs for LITAF Antibody (H00009516-M01)

Learn more about PTMs related to LITAF Antibody (H00009516-M01).
 

Research Areas for LITAF Antibody (H00009516-M01)

Find related products by research area.

Blogs on LITAF

There are no specific blogs for LITAF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LITAF Antibody (2E12) and receive a gift card or discount.

Bioinformatics

Gene Symbol LITAF
Uniprot