Recombinant Human Lipin 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Lipin 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 792-890 of Human LPIN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LPIN1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lipin 1 Protein

  • DKFZp781P1796
  • EC 3.1.3.18
  • EC 3.1.3.4
  • EC 5.4.2.7
  • KIAA0188phosphatidate phosphatase LPIN1
  • Lipin 1
  • lipin-1
  • LPIN1
  • PAP1

Background

This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4064
Species: Mu
Applications: WB, ICC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45378
Species: Hu
Applications: WB, IHC
NBP1-30061
Species: Hu, Mu
Applications: WB, IP
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for Lipin 1 Partial Recombinant Protein (H00023175-Q01) (0)

There are no publications for Lipin 1 Partial Recombinant Protein (H00023175-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipin 1 Partial Recombinant Protein (H00023175-Q01) (0)

There are no reviews for Lipin 1 Partial Recombinant Protein (H00023175-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lipin 1 Partial Recombinant Protein (H00023175-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lipin 1 Products

Lipin 1 H00023175-Q01

Bioinformatics Tool for Lipin 1 Partial Recombinant Protein (H00023175-Q01)

Discover related pathways, diseases and genes to Lipin 1 Partial Recombinant Protein (H00023175-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lipin 1 Partial Recombinant Protein (H00023175-Q01)

Discover more about diseases related to Lipin 1 Partial Recombinant Protein (H00023175-Q01).
 

Pathways for Lipin 1 Partial Recombinant Protein (H00023175-Q01)

View related products by pathway.

PTMs for Lipin 1 Partial Recombinant Protein (H00023175-Q01)

Learn more about PTMs related to Lipin 1 Partial Recombinant Protein (H00023175-Q01).

Blogs on Lipin 1

There are no specific blogs for Lipin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Lipin 1 Antibody
NB110-57150

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lipin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LPIN1
Entrez