PPAP2A Antibody

Images

 
Western Blot: PPAP2A Antibody [NBP2-32057] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Prostate tissue
Immunohistochemistry: PPAP2A Antibody [NBP2-32057] - Staining of human prostate shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPAP2A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPAP2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPAP2A Protein (NBP2-32057PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPAP2A Antibody

  • EC 3.1.3.4
  • lipid phosphate phosphohydrolase 1
  • lipid phosphate phosphohydrolase 1a
  • LLP1a
  • LPP1PAP2a2
  • PAP2
  • PAP2a
  • PAP2-alpha
  • PAP-2aPAP2alpha2
  • PAPalpha1
  • Phosphatidate phosphohydrolase type 2a
  • Phosphatidic acid phosphatase 2a
  • phosphatidic acid phosphatase type 2A
  • phosphatidic acid phosphohydrolase type 2a
  • type 2 phosphatidic acid phosphohydrolase
  • type-2 phosphatidic acid phosphatase alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-31607
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57350
Species: Hu
Applications: WB, ICC/IF
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PPAP2A Antibody (NBP2-32057) (0)

There are no publications for PPAP2A Antibody (NBP2-32057).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAP2A Antibody (NBP2-32057) (0)

There are no reviews for PPAP2A Antibody (NBP2-32057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAP2A Antibody (NBP2-32057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPAP2A Products

Bioinformatics Tool for PPAP2A Antibody (NBP2-32057)

Discover related pathways, diseases and genes to PPAP2A Antibody (NBP2-32057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAP2A Antibody (NBP2-32057)

Discover more about diseases related to PPAP2A Antibody (NBP2-32057).
 

Pathways for PPAP2A Antibody (NBP2-32057)

View related products by pathway.

PTMs for PPAP2A Antibody (NBP2-32057)

Learn more about PTMs related to PPAP2A Antibody (NBP2-32057).
 

Research Areas for PPAP2A Antibody (NBP2-32057)

Find related products by research area.

Blogs on PPAP2A

There are no specific blogs for PPAP2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAP2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAP2A
Uniprot