Lipase A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Lipase A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIPA.
  
  

  Source: E. coli

  Amino Acid Sequence: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LIPA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47397.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lipase A Recombinant Protein Antigen

• Acid cholesteryl ester hydrolase
• CESD
• Cholesteryl esterase
• EC 3.1.1
• EC 3.1.1.13
• LALCESDcholesterol ester hydrolase
• LIPA
• Lipase A
• lipase A, lysosomal acid, cholesterol esterase
• lysosomal acid lipase
• lysosomal acid lipase/cholesteryl ester hydrolase
• Sterol esterase

Background

Lipase A, also known as LIPA or Lysosomal acid lipase/cholesteryl ester hydrolase, has a 399 amino acid long isoform that is 45 kDa and a short 343 amino acid isoform that is 39 kDa; lysosome located; is very important for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles, and also in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. This protein is currently being studied for involvement in the following diseases and disorders: cholesteryl ester storage disease, wolman disease, cholesterol, cholesterol ester storage disease, lysosomal storage disease, coronary heart disease, hepatitis c, splenomegaly, hepatitis b, hepatitis, hyperlipidemia, hypercholesterolemia, tuberculosis, obesity atherosclerosis, alzheimer's disease, neisseria meningitides, lipid storage disease, lipodystrophy, pandas, wolman disease, and blepharitis. The LIPA protein has been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, SOAT1, and HIST1H4E in cholesterol and sphingolipids transport / distribution to the intracellular membrane compartments (normal and CF), steroid biosynthesis, and lysosome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LIPA