Lipase A Recombinant Protein Antigen

Images

 
There are currently no images for Lipase A Protein (NBP2-47397PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lipase A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIPA.

Source: E. coli

Amino Acid Sequence: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47397.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lipase A Recombinant Protein Antigen

  • Acid cholesteryl ester hydrolase
  • CESD
  • Cholesteryl esterase
  • EC 3.1.1
  • EC 3.1.1.13
  • LALCESDcholesterol ester hydrolase
  • LIPA
  • Lipase A
  • lipase A, lysosomal acid, cholesterol esterase
  • lysosomal acid lipase
  • lysosomal acid lipase/cholesteryl ester hydrolase
  • Sterol esterase

Background

Lipase A, also known as LIPA or Lysosomal acid lipase/cholesteryl ester hydrolase, has a 399 amino acid long isoform that is 45 kDa and a short 343 amino acid isoform that is 39 kDa; lysosome located; is very important for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles, and also in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. This protein is currently being studied for involvement in the following diseases and disorders: cholesteryl ester storage disease, wolman disease, cholesterol, cholesterol ester storage disease, lysosomal storage disease, coronary heart disease, hepatitis c, splenomegaly, hepatitis b, hepatitis, hyperlipidemia, hypercholesterolemia, tuberculosis, obesity atherosclerosis, alzheimer's disease, neisseria meningitides, lipid storage disease, lipodystrophy, pandas, wolman disease, and blepharitis. The LIPA protein has been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, SOAT1, and HIST1H4E in cholesterol and sphingolipids transport / distribution to the intracellular membrane compartments (normal and CF), steroid biosynthesis, and lysosome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-88502
Species: Hu
Applications: IHC,  IHC-P
NBP1-85691
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-02948
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB8306
Species: Hu
Applications: IHC, WB
NB110-40760
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP1-88057
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-47397PEP
Species: Hu
Applications: AC

Publications for Lipase A Protein (NBP2-47397PEP) (0)

There are no publications for Lipase A Protein (NBP2-47397PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipase A Protein (NBP2-47397PEP) (0)

There are no reviews for Lipase A Protein (NBP2-47397PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lipase A Protein (NBP2-47397PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lipase A Products

Research Areas for Lipase A Protein (NBP2-47397PEP)

Find related products by research area.

Blogs on Lipase A.

How do Lipase A and the CD36 Antibody Relate to Each Other
Obesity, diabetes and metabolic disorders are dramatically on the increase, linked to disorders such as heart disease, stroke and cancer. To combat this, research groups are studying metabolism at both a cellular and a systemic level. Although we at N...  Read full blog post.

Customers Who Bought This Also Bought


Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lipase A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPA