LINS1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LINS1 Antibody [NBP1-89584] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: LINS1 Antibody [NBP1-89584] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LINS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SRVFIEQDDDMLEAAKASLGIYLTLTRGCEATESLTQGKEMWDHHTHENGYNPHCIFLFFLKNIGFDSTVLLDFLISSETCFLEYFVRYLKLLQKDWDN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LINS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LINS1 Protein (NBP1-89584PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LINS1 Antibody

  • FLJ10583
  • lines homolog (Drosophila)
  • lines homolog 1
  • LINS1
  • protein Lines homolog 1
  • protein Lines homolog
  • WINS1 protein with Drosophila Lines (Lin) homologous domain
  • wnt-signaling molecule Lines homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86157
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-32531
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
AF3927
Species: Hu, Mu, Rt
Applications: WB
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89165
Species: Hu
Applications: IHC, IHC-P

Publications for LINS1 Antibody (NBP1-89584) (0)

There are no publications for LINS1 Antibody (NBP1-89584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LINS1 Antibody (NBP1-89584) (0)

There are no reviews for LINS1 Antibody (NBP1-89584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LINS1 Antibody (NBP1-89584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LINS1 Products

LINS1 NBP1-89584

Bioinformatics Tool for LINS1 Antibody (NBP1-89584)

Discover related pathways, diseases and genes to LINS1 Antibody (NBP1-89584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LINS1 Antibody (NBP1-89584)

Discover more about diseases related to LINS1 Antibody (NBP1-89584).
 

Pathways for LINS1 Antibody (NBP1-89584)

View related products by pathway.

Blogs on LINS1

There are no specific blogs for LINS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LINS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LINS