ISX Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ISX Antibody [NBP2-32531] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ISX Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ISX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ISX Protein (NBP2-32531PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ISX Antibody - BSA Free

• intestine-specific homeobox
• RAXLX

Background

Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development.Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is amember of the RAXLX homeobox gene family. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ISX Antibody (NBP2-32531)(1)

Publication using NBP2-32531

• Lee H, Son My Using Bioengineered Fluorescence for Selective In Vivo and Ex Vivo Tracking of Intestinal Organoids Derived from Human Pluripotent Stem Cells Methods Mol. Biol. 2020-03-01 [PMID: 32112379]

Bioinformatics

• Gene Symbol: ISX