ISX Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ISX Antibody [NBP2-32531] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ISX Antibody [NBP2-32531] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISX Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ISX Protein (NBP2-32531PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ISX Antibody

  • intestine-specific homeobox
  • RAXLX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP2-06984
Species: Hu
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
AF4159
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31318
Species: Mu
Applications: IHC-P

Publications for ISX Antibody (NBP2-32531) (0)

There are no publications for ISX Antibody (NBP2-32531).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISX Antibody (NBP2-32531) (0)

There are no reviews for ISX Antibody (NBP2-32531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ISX Antibody (NBP2-32531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ISX Products

Bioinformatics Tool for ISX Antibody (NBP2-32531)

Discover related pathways, diseases and genes to ISX Antibody (NBP2-32531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ISX Antibody (NBP2-32531)

Discover more about diseases related to ISX Antibody (NBP2-32531).
 

Pathways for ISX Antibody (NBP2-32531)

View related products by pathway.

PTMs for ISX Antibody (NBP2-32531)

Learn more about PTMs related to ISX Antibody (NBP2-32531).

Blogs on ISX

There are no specific blogs for ISX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISX