ASB7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ASB7 Antibody [NBP1-86157] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ASB7 Antibody [NBP1-86157] - Staining in human testis and pancreas tissues using anti-ASB7 antibody. Corresponding ASB7 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ASB7 Antibody [NBP1-86157] - Staining of human testis shows high expression.

Staining of human pancreas shows low expression as expected.

Analysis in control (vector only transfected HEK293T lysate) and aSB7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ASB7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASB7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC-P, Retrieval method: HIER pH6, ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  ASB7 Protein (NBP1-86157PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:33251222)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ASB7 Antibody - BSA Free

• ankyrin repeat and SOCS box containing 7
• ankyrin repeat and SOCS box protein 7
• ankyrin repeat and SOCS box-containing 7
• ASB-7
• FLJ22551
• FLJ25192

Background

ASB7 is a member of the ankyrin repeat and SOCS box family. Within the SOCS box of the ASB proteins are the BC and Cul5 boxes, via which ASB proteins including ASB7 interact with Cul5-Rbx2 as part of some E3 ubiquitin (Ub) ligase complexes. It is thought that the SOCS-containing ASB proteins function as the substrate recognition component of these complexes. E3 Ub ligases label proteins with Ub to target them for degradation by the proteasome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ASB7 Antibody (NBP1-86157)(1)

Publication using NBP1-86157

• Liu Y, Li X, He Y et al. ASB7 Is a Novel Regulator of Cytoskeletal Organization During Oocyte Maturation Front Cell Dev Biol 2020-11-05 [PMID: 33251222] (WB, Mouse)
  
  Details:
  Mouse oocytes, either injected with siRNA or mRNA to knock down or overexpress ASB7, underwent Western blot analysis.

Bioinformatics

• Gene Symbol: ASB7