ASB7 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ASB7 Antibody [NBP1-86157] - Staining in human testis and pancreas tissues using anti-ASB7 antibody. Corresponding ASB7 RNA-seq data are presented for the ...read more
Western Blot: ASB7 Antibody [NBP1-86157] - Analysis in control (vector only transfected HEK293T lysate) and aSB7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: ASB7 Antibody [NBP1-86157] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ASB7 Antibody [NBP1-86157] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ASB7 Antibody [NBP1-86157] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ASB7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASB7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC-P, Retrieval method: HIER pH6, ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
ASB7 Protein (NBP1-86157PEP)
Publications
Read Publication using
NBP1-86157 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:33251222)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASB7 Antibody

  • ankyrin repeat and SOCS box containing 7
  • ankyrin repeat and SOCS box protein 7
  • ankyrin repeat and SOCS box-containing 7
  • ASB-7
  • FLJ22551
  • FLJ25192

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05098
Species: Hu, Mu, Rt
Applications: WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-86157
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ASB7 Antibody (NBP1-86157)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ASB7 Antibody (NBP1-86157) (0)

There are no reviews for ASB7 Antibody (NBP1-86157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASB7 Antibody (NBP1-86157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASB7 Products

Bioinformatics Tool for ASB7 Antibody (NBP1-86157)

Discover related pathways, diseases and genes to ASB7 Antibody (NBP1-86157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASB7 Antibody (NBP1-86157)

Discover more about diseases related to ASB7 Antibody (NBP1-86157).

Research Areas for ASB7 Antibody (NBP1-86157)

Find related products by research area.

Blogs on ASB7

There are no specific blogs for ASB7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASB7