LINGO-1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LINGO-1 Antibody [NBP2-57689] - Staining of human cell line HEK 293 shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining of human liver shows low expression as expected.

Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-57689 antibody. Corresponding LINGO1 RNA-seq data are presented for the same tissues.

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LINGO-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LINGO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
• Control Peptide:

  LINGO-1 Recombinant Protein Antigen (NBP2-57689PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LINGO-1 Antibody - BSA Free

• FLJ14594
• LERN1
• LERN1UNQ201
• leucine rich repeat and Ig domain containing 1
• leucine rich repeat neuronal 6A
• Leucine-rich repeat and immunoglobilin domain-containing protein 1
• Leucine-rich repeat neuronal protein 1
• Leucine-rich repeat neuronal protein 6A
• LINGO1
• LINGO-1
• LRRN6A
• LRRN6Aleucine-rich repeat neuronal 6A
• MGC17422

Background

Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible forsome inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator ofoligodentrocyte differentiation and axonal myelination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LINGO1