LINGO-1 Antibody


Immunocytochemistry/ Immunofluorescence: LINGO-1 Antibody [NBP2-57689] - Staining of human cell line HEK 293 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining in human cerebral cortex and liver tissues using anti-LINGO1 antibody. Corresponding LINGO1 RNA-seq data are more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

LINGO-1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
Specificity of human LINGO-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
Control Peptide
LINGO-1 Recombinant Protein Antigen (NBP2-57689PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for LINGO-1 Antibody

  • FLJ14594
  • LERN1
  • LERN1UNQ201
  • leucine rich repeat and Ig domain containing 1
  • leucine rich repeat neuronal 6A
  • Leucine-rich repeat and immunoglobilin domain-containing protein 1
  • Leucine-rich repeat neuronal protein 1
  • Leucine-rich repeat neuronal protein 6A
  • LINGO1
  • LINGO-1
  • LRRN6A
  • LRRN6Aleucine-rich repeat neuronal 6A
  • MGC17422


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Rb, Sh
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for LINGO-1 Antibody (NBP2-57689) (0)

There are no publications for LINGO-1 Antibody (NBP2-57689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LINGO-1 Antibody (NBP2-57689) (0)

There are no reviews for LINGO-1 Antibody (NBP2-57689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LINGO-1 Antibody (NBP2-57689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LINGO-1 Products

Bioinformatics Tool for LINGO-1 Antibody (NBP2-57689)

Discover related pathways, diseases and genes to LINGO-1 Antibody (NBP2-57689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LINGO-1 Antibody (NBP2-57689)

Discover more about diseases related to LINGO-1 Antibody (NBP2-57689).

Pathways for LINGO-1 Antibody (NBP2-57689)

View related products by pathway.

PTMs for LINGO-1 Antibody (NBP2-57689)

Learn more about PTMs related to LINGO-1 Antibody (NBP2-57689).

Blogs on LINGO-1

There are no specific blogs for LINGO-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LINGO-1 Antibody and receive a gift card or discount.


Gene Symbol LINGO1