Home » LINGO-1 » LINGO-1 Antibodies » LINGO-1 Antibody

LINGO-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: LINGO-1 Antibody [NBP2-57689] - Staining of human cell line HEK 293 shows localization to plasma membrane. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: LINGO-1 Antibody [NBP2-57689] - Staining of human cell line HEK 293 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LINGO-1 Antibody [NBP2-57689] - Staining in human cerebral cortex and liver tissues using anti-LINGO1 antibody. Corresponding LINGO1 RNA-seq data are ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

LINGO-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
Specificity
Specificity of human LINGO-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LINGO1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
Control Peptide
LINGO-1 Recombinant Protein Antigen (NBP2-57689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LINGO-1 Antibody

  • FLJ14594
  • LERN1
  • LERN1UNQ201
  • leucine rich repeat and Ig domain containing 1
  • leucine rich repeat neuronal 6A
  • Leucine-rich repeat and immunoglobilin domain-containing protein 1
  • Leucine-rich repeat neuronal protein 1
  • Leucine-rich repeat neuronal protein 6A
  • LINGO1
  • LINGO-1
  • LRRN6A
  • LRRN6Aleucine-rich repeat neuronal 6A
  • MGC17422

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nogo Receptor/NgR
Antibody
AF1440
Nogo Receptor/NgR Antibody
(2 Reviews)
(12 Publications)
Species: Mu
Applications: WB
LINGO-1 Antibody
[Unconjugated]
AF3086
LINGO‑1 was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Human LINGO‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3086) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the dorsal horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(2 Publications)
Species: Hu
Applications: WB, IHC
TROY/TNFRSF19
Antibody
NB120-12126
Western Blot: TROY Antibody [NB120-12126] - Analysis of TROY using NB120-12126 in T98G, a human glioblastoma cell line lysate. A protein band of approximately 46 kD is detected.
Species: Hu, Mu
Applications: WB

NGFR/TNFRSF16/p75NTR A ...
MAB367
NGF R/TNFRSF16 was detected in immersion fixed canine mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed human mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using 25 µg/mL Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Nogo Antibody
NB100-56681
Western Blot: Nogo Antibody [NB100-56681] - Analysis of Nogo A and B in A) human, B) mouse, and C) rat brain tissue lysate using Nogo antibody at 1:2000.
Immunohistochemistry-Paraffin: Nogo Antibody [NB100-56681] - Analysis of human testis using Nogo antibody at 1:100.
Simple Western: Nogo Antibody [NB100-56681] - Lane view shows a specific band for Nogo in 0.05 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(16 Publications)
Species: Hu, Mu, Rt, Rb, Sh
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
MAG/Siglec-4a
538-MG
MAG/Siglec-4a
(1 Review)
(18 Publications)
Species: Rt
TNF RII/TNFRSF1B
[HRP]
DRT200
(1 Review)
(60 Publications)
Species: Hu
IL-2 R beta
Antibody (27302)
MAB224
IL‑2 R beta was detected in immersion fixed frozen sections of human lymph node using 15 µg/mL Mouse Anti-Human IL‑2 R beta Monoclonal Antibody (Catalog # MAB224) overnight at 4 °C. Tissue was stained (red) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Recombinant Human IL‑2 (Catalog # 202-IL) stimulates proliferation in the MO7e human megakaryocytic leukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human IL‑2 (30 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL‑2 R beta Monoclonal Antibody (Catalog # MAB224). The ND50 is typically 0.05‑0.15 µg/mL.
(5 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
KHSRP Antibody
NBP1-18910
Simple Western: KHSRP Antibody [NBP1-18910] - Simple Western lane view shows a specific band for KHSRP in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry: KHSRP Antibody [NBP1-18910] - Immunofluorescence of ILF3 and KHSRP in the retina. Retinal sections were prepared from control mice and from mice at one day after light exposure and stained for GS (green) and KHSRP (red). Image collected and cropped by CiteAb from the following publication (http://bmcbiol.biomedcentral.com/articles/10.1186/s12915-015-0137-1), licensed under a CC-BY licence.
Western Blot: KHSRP Antibody [NBP1-18910] - Whole cell lysate from HeLa, 293T and mouse NIH3T3 cells. KSRP was also immunoprecipitated by rabbit anti-KSRP antibody NBP1-18911.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
LEDGF Antibody
(762815)
MAB3468
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. Gels were loaded with 40 µg of cytoplasmic (Cyto) and 20 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for LEDGF p75 at approximately 75 kDa and LEDGF p52 at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
LEDGF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC
HCLS1 Antibody
(1A8)
H00003059-M02
Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody (M02), clone 1A8.Lane 1: HCLS1 transfected lysate(54 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi ( Cat # H00003059-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HCLS1 monoclonal antibody (M02), clone 1A8 (Cat # H00003059-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
CDP/CUTL1 Antibody
NBP2-13883
Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
Siglec-7/CD328
Antibody [Unconjugate
AF1138
Recombinant Human Siglec‑7 Fc Chimera (Catalog # 1138-SL), immobilized onto a microplate, supports the adhesion of human red blood cells in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Human Siglec‑7 Fc Chimera (1.5 µg/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Siglec‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1138). The ND50 is typically 0.3-0.9 µg/mL.
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
BDNF [HRP]
DBD00
(4 Reviews)
(53 Publications)
Species: Hu
OMgp Antibody
NBP1-82483
Western Blot: OMgp Antibody [NBP1-82483] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human cerebral cortex shows high expression.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
RhoA Antibody
NB100-91273
Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MOG Antibody
H00004340-B01P
Western Blot: MOG Antibody [H00004340-B01P] - Analysis of MOG expression in rat brain.
Western Blot: MOG Antibody [H00004340-B01P] - Analysis of MOG expression in transfected 293T cell line by MOG polyclonal antibody. Lane 1: MOG transfected lysate(32.56 KDa). Lane 2: Non-transfected lysate.
(1 Review)
Species: Hu, Rt
Applications: WB
LINGO-2 Antibody
(382007) [Unconjugate ...
MAB36791
HEK293 human embryonic kidney cell line either (A) transfected with human LINGO-2 or (B) irrelevant transfectants and eGFP was stained with Mouse Anti-Human LINGO‑2 Monoclonal Antibody (Catalog # MAB36791) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). Quadrant markers were set based on control antibody staining (Catalog # MAB003).
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human LINGO‑2 Monoclonal Antibody (Catalog # MAB36791) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for LINGO‑2 at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A549 human lung carcinoma cell line was stained with Human LINGO‑2 Monoclonal Antibody (Catalog # MAB36791, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0101B).
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for LINGO-1 Antibody (NBP2-57689) (0)

There are no publications for LINGO-1 Antibody (NBP2-57689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LINGO-1 Antibody (NBP2-57689) (0)

There are no reviews for LINGO-1 Antibody (NBP2-57689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LINGO-1 Antibody (NBP2-57689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional LINGO-1 Products

Bioinformatics Tool for LINGO-1 Antibody (NBP2-57689)

Discover related pathways, diseases and genes to LINGO-1 Antibody (NBP2-57689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LINGO-1 Antibody (NBP2-57689)

Discover more about diseases related to LINGO-1 Antibody (NBP2-57689).
 

Pathways for LINGO-1 Antibody (NBP2-57689)

View related products by pathway.

PTMs for LINGO-1 Antibody (NBP2-57689)

Learn more about PTMs related to LINGO-1 Antibody (NBP2-57689).

Blogs on LINGO-1

There are no specific blogs for LINGO-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LINGO-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LINGO1