LHX3 Antibody


Western Blot: LHX3 Antibody [NBP2-84135] - WB Suggested Anti-LHX3 Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysate
Immunohistochemistry: LHX3 Antibody [NBP2-84135] - Human Heart
Immunohistochemistry: LHX3 Antibody [NBP2-84135] - Human Lung

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LHX3 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human LHX3. Peptide sequence: QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEV The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Protein A purified

Alternate Names for LHX3 Antibody

  • CPHD3
  • DKFZp762A2013
  • LIM homeobox 3
  • LIM homeobox protein 3
  • LIM/homeobox protein Lhx3
  • LIM/homeodomain protein LHX3
  • LIM3
  • M2-LHX3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P

Publications for LHX3 Antibody (NBP2-84135) (0)

There are no publications for LHX3 Antibody (NBP2-84135).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX3 Antibody (NBP2-84135) (0)

There are no reviews for LHX3 Antibody (NBP2-84135). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHX3 Antibody (NBP2-84135) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LHX3 Products

Bioinformatics Tool for LHX3 Antibody (NBP2-84135)

Discover related pathways, diseases and genes to LHX3 Antibody (NBP2-84135). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHX3 Antibody (NBP2-84135)

Discover more about diseases related to LHX3 Antibody (NBP2-84135).

Pathways for LHX3 Antibody (NBP2-84135)

View related products by pathway.

PTMs for LHX3 Antibody (NBP2-84135)

Learn more about PTMs related to LHX3 Antibody (NBP2-84135).

Blogs on LHX3.

A good helper on validating your FLOW and IHC data - Rabbit IgG Isotype Control
Isotype controls are primarily used as negative controls in flow cytometry but they can also be used for immunohistochemistry. They are used to approximate the non-specific target primary antibody binding due to protein-protein interactions, binding t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LHX3 Antibody and receive a gift card or discount.


Gene Symbol LHX3