Lgr5/GPR49 Recombinant Protein Antigen

Images

 
There are currently no images for Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lgr5/GPR49 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGR5.

Source: E. coli

Amino Acid Sequence: AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGR5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54660.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lgr5/GPR49 Recombinant Protein Antigen

  • FEX
  • G protein-coupled receptor 49
  • GPR49
  • GPR49G-protein coupled receptor HG38
  • GPR67
  • G-protein coupled receptor 49
  • G-protein coupled receptor 67
  • GRP49
  • HG38
  • leucine-rich repeat containing G protein-coupled receptor 5
  • leucine-rich repeat-containing G protein-coupled receptor 5
  • leucine-rich repeat-containing G-protein coupled receptor 5
  • Lgr5
  • MGC117008
  • orphan G protein-coupled receptor HG38

Background

Leucine-rich repeat-containing LGR5, also known as GPR49, is an Orphan-A G-protein coupled receptor with an unknown ligand. GPR49 is a stem cell marker of the intestinal epithelium and the hair follicule, and is often expressed in the brain, skeletal muscle, placenta, and spinal cord. Because LGR5 is typically found in mouse hair follicles it may potentially be used to regrow hair in mice. GPR49/LGR5 antibodies are useful tools for research on hair loss and hair follicule development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
AF2628
Species: Hu, Mu, Rt
Applications: ICC, IHC, WB
NBP1-77127
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB7750
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1172
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
DY413
Species: Mu
Applications: ELISA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
7150-RS/CF
Species: Mu
Applications: BA
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-54660PEP
Species: Hu
Applications: AC

Publications for Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP) (0)

There are no publications for Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP) (0)

There are no reviews for Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lgr5/GPR49 Products

Research Areas for Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP)

Find related products by research area.

Blogs on Lgr5/GPR49.

Meeting Report: 2nd International Antibody Validation Meeting
Bio-Techne brands Novus Biologicals® and R&D Systems® were proud to support the 2nd International Antibody Validation Meeting held at Bath University, on the 15-16 September, 2016. Almost 100 participants from around the world, including funde...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lgr5/GPR49 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LGR5