Lgr5/GPR49 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Lgr5/GPR49 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGR5.
  
  

  Source: E. coli

  Amino Acid Sequence: AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LGR5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54660.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lgr5/GPR49 Recombinant Protein Antigen

• FEX
• G protein-coupled receptor 49
• GPR49
• GPR49G-protein coupled receptor HG38
• GPR67
• G-protein coupled receptor 49
• G-protein coupled receptor 67
• GRP49
• HG38
• leucine-rich repeat containing G protein-coupled receptor 5
• leucine-rich repeat-containing G protein-coupled receptor 5
• leucine-rich repeat-containing G-protein coupled receptor 5
• Lgr5
• MGC117008
• orphan G protein-coupled receptor HG38

Background

Leucine-rich repeat-containing LGR5, also known as GPR49, is an Orphan-A G-protein coupled receptor with an unknown ligand. GPR49 is a stem cell marker of the intestinal epithelium and the hair follicule, and is often expressed in the brain, skeletal muscle, placenta, and spinal cord. Because LGR5 is typically found in mouse hair follicles it may potentially be used to regrow hair in mice. GPR49/LGR5 antibodies are useful tools for research on hair loss and hair follicule development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LGR5