LEO1 Antibody

Images

 
Western Blot: LEO1 Antibody [NBP1-86236] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: LEO1 Antibody [NBP1-86236] - Staining of human rectum shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LEO1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DEERAQGSDEDKLQNSDDDEKMQNTGDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEGQPQLSDEEKMQNSDDER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LEO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LEO1 Protein (NBP1-86236PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LEO1 Antibody

  • Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
  • RDLReplicative senescence down-regulated leo1-like protein
  • RNA polymerase-associated protein LEO1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-184
Species: Hu, Mu
Applications: WB, IP
NB600-273
Species: Hu, Mu, Rt
Applications: WB
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-61052
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
31310002
Species: Hu
Applications: WB, ELISA
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
AF1726
Species: Hu
Applications: WB, IHC, ICC
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP

Publications for LEO1 Antibody (NBP1-86236) (0)

There are no publications for LEO1 Antibody (NBP1-86236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEO1 Antibody (NBP1-86236) (0)

There are no reviews for LEO1 Antibody (NBP1-86236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEO1 Antibody (NBP1-86236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LEO1 Products

Bioinformatics Tool for LEO1 Antibody (NBP1-86236)

Discover related pathways, diseases and genes to LEO1 Antibody (NBP1-86236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEO1 Antibody (NBP1-86236)

Discover more about diseases related to LEO1 Antibody (NBP1-86236).
 

Pathways for LEO1 Antibody (NBP1-86236)

View related products by pathway.

PTMs for LEO1 Antibody (NBP1-86236)

Learn more about PTMs related to LEO1 Antibody (NBP1-86236).
 

Research Areas for LEO1 Antibody (NBP1-86236)

Find related products by research area.

Blogs on LEO1

There are no specific blogs for LEO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LEO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LEO1