LECT2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LECT2 Antibody [NBP3-17731] - Staining of human cell line U-2 OS shows localization to cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LECT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LECT2 Antibody - BSA Free (NBP3-17731) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LECT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LECT2 Antibody - BSA Free

• chm2
• chm-II
• Chondromodulin II
• chondromodulin-II
• hLECT2
• LECT2
• LECT-2
• leukocyte cell-derived chemotaxin 2
• leukocyte cell-derived chemotaxin-2
• MGC126628
• MIM1

Background

The LECT2 gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-indu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LECT2