LCoR Antibody

Western Blot: LCoR Antibody [NBP1-83477] - Analysis in human cell line RT-4.

Product Discontinued

LCoR Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCOR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: IHC-P reported in scientific literature (PMID: 30007204). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LCoR Protein (NBP1-83477PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LCoR Antibody

• FLJ38026
• KIAA1795RP11-175O19.1
• LCoR
• ligand dependent nuclear receptor corepressor
• Mblk1-related protein 2
• MLR2
• MLR2ligand-dependent corepressor

Background

LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LCoR Antibody (NBP1-83477)(2)

Publications using NBP1-83477

• Vogelsang Tlr, Schmoeckel E, Kuhn C et Al. Regulation of LCoR and RIP140 expression in cervical intraepithelial neoplasia and correlation with CIN progression and dedifferentiation J. Cancer Res. Clin. Oncol. 2020-03-10 [PMID: 32157438] (IF/IHC, IHC-P, Human)
• Sixou S, Muller k, Jalaguier S et al. Importance of RIP140 and LCoR Sub-Cellular Localization for Their Association With Breast Cancer Aggressiveness and Patient Survival. Transl Oncol. 2018-07-11 [PMID: 30007204] (IHC-P, Human)

Bioinformatics

• Gene Symbol: LCOR