LCLAT1 Antibody - BSA Free

Western Blot: LCLAT1 Antibody [NBP1-59347] - Sample Tissue: Human 721_B cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25ug/lane/lane

Western Blot: LCLAT1 Antibody [NBP1-59347] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Western Blot: LCLAT1 Antibody [NBP1-59347] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LCLAT1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to LYCAT(lysocardiolipin acyltransferase) The peptide sequence was selected from the middle region of human LYCAT. Peptide sequence YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCLAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LCLAT1 Antibody - BSA Free

• 1-acylglycerol-3-phosphate O-acyltransferase 8
• 1-AGPAT 8
• Acyl-CoA:lysocardiolipin acyltransferase 1
• AGPAT8lysocardiolipin acyltransferase
• ALCAT11AGPAT8
• EC 2.3.1.-
• EC 2.3.1.51
• FLJ37965
• HSRG1849
• LYCAT
• lysocardiolipin acyltransferase 1
• UNQ1849,1-AGP acyltransferase 8

Background

LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LCLAT1 Antibody (NBP1-59347)(1)

Publication using NBP1-59347

• Eirin A, Ebrahimi B, Kwon SH et al. Restoration of Mitochondrial Cardiolipin Attenuates Cardiac Damage in Swine Renovascular Hypertension. J Am Heart Assoc 2016-05-31 [PMID: 27247333] (WB)

Bioinformatics

• Gene Symbol: LCLAT1
• Entrez:
  • 253558(Human)
• Uniprot:
  • B4DYR5(Human)