![Western Blot: LASS6 Antibody (6B8) [H00253782-M02] - LASS6 monoclonal antibody (M02), clone 6B8. Analysis of LASS6 expression in PC-12.](http://images.novusbio.com/fullsize/LASS6-Antibody-6B8-Western-Blot-H00253782-M02-img0005.jpg "Western Blot: LASS6 Antibody (6B8) [H00253782-M02] - LASS6 monoclonal antibody (M02), clone 6B8. Analysis of LASS6 expression in PC-12.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 6B8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse LASS6 Antibody (6B8) - Azide and BSA Free (H00253782-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR |
| Specificity | LASS6 - LAG1 longevity assurance homolog 6 (S. cerevisiae) (6B8) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CERS6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: LASS6 Antibody (6B8) [H00253782-M02] - LASS6 monoclonal antibody (M02), clone 6B8 Analysis of LASS6 expression in Jurkat.](http://images.novusbio.com/fullsize/LASS6-Antibody-6B8-Western-Blot-H00253782-M02-img0006.jpg "Western Blot: LASS6 Antibody (6B8) [H00253782-M02] - LASS6 monoclonal antibody (M02), clone 6B8 Analysis of LASS6 expression in Jurkat.")
![ELISA: LASS6 Antibody (6B8) [H00253782-M02] - Detection limit for recombinant GST tagged LASS6 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/LASS6-Antibody-6B8-Sandwich-ELISA-H00253782-M02-img0004.jpg "ELISA: LASS6 Antibody (6B8) [H00253782-M02] - Detection limit for recombinant GST tagged LASS6 is approximately 0.1ng/ml as a capture antibody.")
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
