LASS6 Antibody (5H7) - Azide and BSA Free

Western Blot: LASS6 Antibody (5H7) [H00253782-M01] - LASS6 monoclonal antibody (M01), clone 5H7 Analysis of LASS6 expression in HeLa.

Immunohistochemistry-Paraffin: LASS6 Antibody (5H7) [H00253782-M01] - Analysis of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.

ELISA: LASS6 Antibody (5H7) [H00253782-M01] - Detection limit for recombinant GST tagged LASS6 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC, IP
• Clone: 5H7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LASS6 Antibody (5H7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LASS6 Antibody (5H7) - Azide and BSA Free (H00253782-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and IP. Anti-LASS6 Antibody: Cited in 16 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
• Specificity: LASS6 - LAG1 longevity assurance homolog 6 (S. cerevisiae)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CERS6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. Use in immunprecipitation reported in scientific literature (PMID 26620563)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26620563)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LASS6 Antibody (5H7) - Azide and BSA Free

• CerS6
• LAG1 homolog, ceramide synthase 6
• LAG1 longevity assurance homolog 6 (S. cerevisiae)
• LAG1 longevity assurance homolog 6
• longevity assurance homolog 6
• MGC129949
• MGC129950

Background

LASS6 may be involved in sphingolipid synthesis or its regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LASS6 Antibody (H00253782-M01)(16)

Publications using H00253782-M01

• Straus AJ, Mavodza G, Senkal CE. et Al. Glycosylation of ceramide synthase 6 is required for its activity J Lipid Res 2024-11-26 [PMID: 39608570]
• Wing-Kee L, Michelle M, Amy Q et al. Dependence of ABCB1 transporter expression and function on distinct sphingolipids generated by ceramide synthases-2 and -6 in chemoresistant renal cancer. J Biol Chem. 2021-12-13 [PMID: 34915026]
• Trishna P, Kajal R, Animesh K et al. Alternative splicing of ceramide synthase 2 alters levels of specific ceramides and modulates cancer cell proliferation and migration in Luminal B breast cancer subtype. Cell Death Dis. 2021-02-10 [PMID: 33568634]
• Motoshi S, Ke C, Seiichi K et al. CERS6 required for cell migration and metastasis in lung cancer. J Cell Mol Med. 2020-09-09 [PMID: 32902157]
• Uen YH, Fang CL, Lin CC et al. Ceramide synthase 6 predicts the prognosis of human gastric cancer: it functions as an oncoprotein by dysregulating the SOCS2/JAK2/STAT3 pathway. Mol Carcinog 2018-08-29 [PMID: 30129684]
• Li S, Wu Y, Ding Y et al. CerS6 regulates cisplatin resistance in oral squamous cell carcinoma by altering mitochondrial fission and autophagy. J Cell Physiol 2018-07-27 [PMID: 30054909]
• Gerl MJ, Bittl V, Kirchner S et al. Sphingosine-1-Phosphate Lyase Deficient Cells as a Tool to Study Protein Lipid Interactions. PLoS One 2016-04-21 [PMID: 27100999] (WB)
• Suzuki M, Cao K, Kato S et al. Targeting ceramide synthase 6-dependent metastasis-prone phenotype in lung cancer cells. J Clin Invest 2015-12-07 [PMID: 26650179]
• Novgorodov SA, Riley CL, Keffler JA et al. SIRT3 Deacetylates Ceramide Synthases: Implications for Mitochondrial Dysfunction and Brain Injury. J. Biol. Chem. 2015-11-30 [PMID: 26620563] (IP, WB, Mouse)
• Jensen SA, Calvert AE, Volpert G et al. Bcl2L13 is a ceramide synthase inhibitor in glioblastoma. Proc Natl Acad Sci U S A. 2014-03-31 [PMID: 24706805]
• Laviad EL, Kelly S, Merrill AH Jr et al. Modulation of ceramide synthase activity via dimerization. J Biol Chem 2012-04-13 [PMID: 22539345]
• Yamane M, Miyazawa K, Moriya S et al. D,l-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells. Biochimie. 2011-05-07 [PMID: 21571032]
• Mullen TD, Spassieva S, Jenkins RW et al. Selective knockdown of ceramide synthases reveals complex interregulation of sphingolipid metabolism. J Lipid Res. 2011-01-01 [PMID: 20940143]
• Maruyama H, Morino H, Ito H et al. Mutations of optineurin in amyotrophic lateral sclerosis. Nature. 2010-04-18 [PMID: 20428114]
• Mesicek J, Lee H, Feldman T et al. Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells. Cell Signal. 2010-04-18 [PMID: 20406683]
• Ruckhaberle E, Holtrich U, Engels K et al. Acid ceramidase 1 expression correlates with a better prognosis in ER-positive breast cancer. Climacteric. 2009-07-31 [PMID: 19657789]

Bioinformatics

• Gene Symbol: CERS6
• Entrez:
  • 253782(Human)
• Uniprot:
  • NP_982288(Human)