LASS6 Antibody (5H7)

Images

 
Western Blot: LASS6 Antibody (5H7) [H00253782-M01] - LASS6 monoclonal antibody (M01), clone 5H7 Analysis of LASS6 expression in HeLa.
Immunohistochemistry-Paraffin: LASS6 Antibody (5H7) [H00253782-M01] - Analysis of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
ELISA: LASS6 Antibody (5H7) [H00253782-M01] - Detection limit for recombinant GST tagged LASS6 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IP
Clone
5H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LASS6 Antibody (5H7) Summary

Immunogen
LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Specificity
LASS6 - LAG1 longevity assurance homolog 6 (S. cerevisiae)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CERS6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. Use in immunprecipitation reported in scientific literature (PMID 26620563)
Publications
Read Publications using
H00253782-M01 in the following applications:

  • IP
    1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26620563)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LASS6 Antibody (5H7)

  • CerS6
  • LAG1 homolog, ceramide synthase 6
  • LAG1 longevity assurance homolog 6 (S. cerevisiae)
  • LAG1 longevity assurance homolog 6
  • longevity assurance homolog 6
  • MGC129949
  • MGC129950

Background

LASS6 may be involved in sphingolipid synthesis or its regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LASS6 Antibody (H00253782-M01)(15)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 10 of 15. Show All 15 Publications.
Publications using H00253782-M01 Applications Species
Wing-Kee L, Michelle M, Amy Q et al. Dependence of ABCB1 transporter expression and function on distinct sphingolipids generated by ceramide synthases-2 and -6 in chemoresistant renal cancer. J Biol Chem. 2021-12-13 [PMID: 34915026]
Trishna P, Kajal R, Animesh K et al. Alternative splicing of ceramide synthase 2 alters levels of specific ceramides and modulates cancer cell proliferation and migration in Luminal B breast cancer subtype. Cell Death Dis. 2021-02-10 [PMID: 33568634]
Motoshi S, Ke C, Seiichi K et al. CERS6 required for cell migration and metastasis in lung cancer. J Cell Mol Med. 2020-09-09 [PMID: 32902157]
Uen YH, Fang CL, Lin CC et al. Ceramide synthase 6 predicts the prognosis of human gastric cancer: it functions as an oncoprotein by dysregulating the SOCS2/JAK2/STAT3 pathway. Mol Carcinog 2018-08-29 [PMID: 30129684]
Li S, Wu Y, Ding Y et al. CerS6 regulates cisplatin resistance in oral squamous cell carcinoma by altering mitochondrial fission and autophagy. J Cell Physiol 2018-07-27 [PMID: 30054909]
Gerl MJ, Bittl V, Kirchner S et al. Sphingosine-1-Phosphate Lyase Deficient Cells as a Tool to Study Protein Lipid Interactions. PLoS One 2016-04-21 [PMID: 27100999] (WB) WB
Suzuki M, Cao K, Kato S et al. Targeting ceramide synthase 6-dependent metastasis-prone phenotype in lung cancer cells. J Clin Invest 2015-12-07 [PMID: 26650179]
Novgorodov SA, Riley CL, Keffler JA et al. SIRT3 Deacetylates Ceramide Synthases: Implications for Mitochondrial Dysfunction and Brain Injury. J. Biol. Chem. 2015-11-30 [PMID: 26620563] (IP, WB, Mouse) IP, WB Mouse
Jensen SA, Calvert AE, Volpert G et al. Bcl2L13 is a ceramide synthase inhibitor in glioblastoma. Proc Natl Acad Sci U S A. 2014-03-31 [PMID: 24706805]
Laviad EL, Kelly S, Merrill AH Jr et al. Modulation of ceramide synthase activity via dimerization. J Biol Chem 2012-04-13 [PMID: 22539345]
Show All 15 Publications.

Reviews for LASS6 Antibody (H00253782-M01) (0)

There are no reviews for LASS6 Antibody (H00253782-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LASS6 Antibody (H00253782-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LASS6 Antibody (5H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CERS6
Entrez
Uniprot