Home » ASC1 » ASC1 Antibodies » ASC1 Antibody

ASC1 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ASC1 Antibody [NBP1-89656] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA
Specificity
Specificity of human, mouse, rat ASC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASC1 Protein (NBP1-89656PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-89656 in the following applications:
Publications
Read Publication using
NBP1-89656 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASC1 Antibody

  • activating signal cointegrator 1
  • ASC-1
  • HsT17391
  • thyroid hormone receptor interactor 4
  • thyroid receptor interacting protein 4
  • Thyroid receptor-interacting protein 4
  • TR-interacting protein 4
  • TRIP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASC/TMS1 Antibody
NBP1-78977
Western Blot: ASC/TMS1 Antibody [NBP1-78977] - Whole cell protein from (1) THP1 and (2) HL60 was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 4.0 ug/ml anti-ACS/TMS1 in 1% milk, and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: ASC/TMS1 Antibody [NBP1-78977] - Tested in MCF-7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: ASC/TMS1 Antibody [NBP1-78977] - Tested in mouse intestine at a 1:400 dilution.
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IM, IP
RACK1/GNB2L1
Antibody (OTI2D8)
NBP2-00612
Western Blot: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GNB2L1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GNB2L1.
Immunohistochemistry-Paraffin: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - Staining of paraffin-embedded Human lymph node tissue using anti-GNB2L1 mouse monoclonal antibody.
Flow Cytometry: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GNB2L1 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
SLC7A10 Antibody
NBP2-38816
Immunohistochemistry-Paraffin: SLC7A10 Antibody [NBP2-38816] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
Species: Hu
Applications: IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(13 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NFkB p50 (NLS)
Inhibitor Peptide Set
NBP2-29323
Functional (Inhibition): NFkB p105/p50 Inhibitor Peptide Set [NBP2-29323] - TLR5/NF-kB/SEAPorter HEK 293 (NBP2-26277) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29323) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Flagellin (NBP2-25289) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).
(12 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
CD98 Antibody
(1C11.7E3)
NBP2-36491
Western Blot: CD98 Antibody (1C11.7E3) [NBP2-36491] - Western blot analysis of human CD98 in recombinant protein, A431, Jurkat, HeLa and HepG2 lysates at 2.0 ug/ml.
Immunohistochemistry-Paraffin: CD98 Antibody (1C11.7E3) [NBP2-36491] - IHC analysis of formalin-fixed paraffin-embedded tissue section of human kidney using CD98 antibody (clone 1C11.7E3) at 1:300 dilution. The antibody generated a distinct/intense membranous staining with relatively weaker cytoplasmic signal, and the immunostaining was exclusively observed in tubular epithelial cells with no signal in the Bowman's capsules.
Flow (Cell Surface): CD98 Antibody (1C11.7E3) [NBP2-36491] - Flow cytometry analysis of human CD98 in hPBMC. Primary antibody was used at 2.5 ug / million cells. Goat anti-mouse IgG (PE) was used at 0.5 ug / million cells. The red shift line represents the primary antibody, the blue line represents the cells alone and the green line represents the isotype control.
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
SLC1A5 Antibody
NBP1-89327
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human prostate and skeletal muscle tissues. Corresponding SLC1A5 RNA-seq data are presented for the same tissues.
Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in human cell line NB4.
Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CDP/CUTL1 Antibody
NBP2-13883
Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
(85 Publications)
Species: Hu, Mu, Rt
WNK1 Antibody
NB600-225
Western Blot: WNK1 Antibody [NB600-225] - Detection of the short form of WNK1 in F-11 cell lysate.
Immunocytochemistry/Immunofluorescence: WNK1 Antibody [NB600-225] - WNK1 antibody was tested in HEK293 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Western Blot: GRASP65 Antibody (5G8) [NBP2-02665] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GRASP65 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: GRASP65 Antibody (OTI5G8) [NBP2-02665] - Staining in Hela cells: red CFTR, Green GRASP65 and Blue is DAPI. Image from a verified customer review.
Immunohistochemistry-Paraffin: GRASP65 Antibody (5G8) [NBP2-02665] - Staining of paraffin-embedded Human prostate tissue using anti-GRASP65 mouse monoclonal antibody.
(3 Reviews)
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Western Blot: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC1.
Immunocytochemistry/Immunofluorescence: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] Staining of COS7 cells transiently transfected by pCMV6-ENTRY ASCC1.
Immunohistochemistry-Paraffin: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - Staining of paraffin-embedded Human tonsil using anti-ASCC1 mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Synaptotagmin 1
Antibody (ASV48)
MAB4364
Synaptotagmin‑1 was detected in immersion fixed rat hippocampal neurons (E18) using Mouse Anti-Rat Synaptotagmin‑1 Monoclonal Antibody (Catalog # MAB4364) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to synapses. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Synaptotagmin was detected in perfusion fixed frozen sections of rat spinal cord using 8 µg/mL Mouse Anti-Rat Synaptotagmin Monoclonal Antibody (Catalog # MAB4364) overnight at 4 °C. Tissue was stained (red) and counter­stained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
SH-SY5Y human neuroblastoma cells were cultured overnight in the presence of 1 mM Retinoic Acid (Catalog # 0695/50) prior to immersion fixation. Synaptotagmin-1 was detected using a Mouse Anti-Rat Synaptotagmin-1 Monoclonal Antibody (Catalog # MAB4364). The cells were stained with the NorthernLights 557-conjugated Donkey Anti-Mouse IgG Affinity-purified Secondary Antibody (red; Catalog # NL007). The cell nuclei were counterstained with DAPI (blue). Synaptotagmin-1 immunoreactivity was localized to synaptic vesicles in the cytoplasm and on the plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Rt
Applications: WB, IHC, IP, ICC
Serum Response
Factor SRF Antibody
NBP1-33063
Western Blot: Serum Response Factor SRF Antibody [NBP1-33063] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE, antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: Serum Response Factor SRF Antibody [NBP1-33063] - Paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Serum Response Factor SRF Antibody [NBP1-33063] - Mouse lung SRF dilution: 1:500. Antigen Retrieval: TrilogyTM (EDTA based) buffer, 15min
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and lymph node tissues using NBP2-38530 antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Species: Hu
Applications: WB, IHC, IHC-P, KD
AKR1B1 Antibody
NBP1-89146
Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ASC1 Antibody
NBP1-89656
ASC1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ASC1 Antibody (NBP1-89656)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for ASC1 Antibody (NBP1-89656) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89656:
Filter by Applications
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
ASC1 NBP1-89656
Enlarge 		4
reviewed by:
Anonymous
 Human 07/13/2020
View

Summary

Sample TestedSkeletal muscle
SpeciesHuman
LotA107250

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASC1 Antibody (NBP1-89656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ASC1 Products

Bioinformatics Tool for ASC1 Antibody (NBP1-89656)

Discover related pathways, diseases and genes to ASC1 Antibody (NBP1-89656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASC1 Antibody (NBP1-89656)

Discover more about diseases related to ASC1 Antibody (NBP1-89656).
 

Pathways for ASC1 Antibody (NBP1-89656)

View related products by pathway.

Research Areas for ASC1 Antibody (NBP1-89656)

Find related products by research area.

Blogs on ASC1

There are no specific blogs for ASC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
ASC1 NBP1-89656
Enlarge
 Anonymous
07/13/2020
Application:
Species: Human
read this review

Bioinformatics

Gene Symbol TRIP4