Home » ASC1 » ASC1 Antibodies » ASC1 Antibody

ASC1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ASC1 Antibody [NBP1-89656] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA
Specificity
Specificity of human, mouse, rat ASC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASC1 Protein (NBP1-89656PEP)
Publications
Read Publication using
NBP1-89656 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASC1 Antibody

  • activating signal cointegrator 1
  • ASC-1
  • HsT17391
  • thyroid hormone receptor interactor 4
  • thyroid receptor interacting protein 4
  • Thyroid receptor-interacting protein 4
  • TR-interacting protein 4
  • TRIP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASC/TMS1 Antibody
NBP1-78977
Western Blot: ASC/TMS1 Antibody [NBP1-78977] - Western Blot Image of anti-ACS/TMS1. Whole cell protein from THP1 (lane 1) and HL60 (lane 2) was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 4.0 ug/ml anti-ACS/TMS1 in 1% milk, and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: ASC/TMS1 Antibody [NBP1-78977] - ASC/TMS1 antibody was tested in MCF-7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: ASC/TMS1 Antibody [NBP1-78977] - IHC of ASC/TMS1 in mouse intestine at a 1:400 dilution.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
RACK1/GNB2L1
Antibody (OTI2D8)
NBP2-00612
Western Blot: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GNB2L1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GNB2L1.
Immunohistochemistry-Paraffin: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - Staining of paraffin-embedded Human lymph node tissue using anti-GNB2L1 mouse monoclonal antibody.
Flow Cytometry: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GNB2L1 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
Immunohistochemistry: Steroid sulfatase Antibody [NBP1-90095] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
SLC7A10 Antibody
NBP1-88814
Immunohistochemistry-Paraffin: SLC7A10 Antibody [NBP1-88814] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Western blot analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Immunofluorescence analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: c-jun Antibody (5B1) [NBP2-37576] - Immunohistochemical analysis of paraffin-embedded human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NFkB p50 (NLS)
Inhibitor Peptide Set
NBP2-29323
Functional (Inhibition): NFkB p105/p50 Inhibitor Peptide Set [NBP2-29323] - TLR5/NF-kB/SEAPorter HEK 293 (NBP2-26277) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29323) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Flagellin (NBP2-25289) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).
(10 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
CD98 Antibody
NBP2-47515
Western Blot: CD98 Antibody [NBP2-47515] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: CD98 Antibody [NBP2-47515] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane and cytosol.
Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining in human parathyroid gland and skeletal muscle tissues using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SLC1A5 Antibody
NBP1-89327
Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human kidney shows strong luminal membranous positivity in cells in tubules.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 5 ug/ml.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
(75 Publications)
Species: Hu, Mu, Rt
WNK1 Antibody
NB600-225
Western Blot: WNK1 Antibody [NB600-225] - Detection of the short form of WNK1 in F-11 cell lysate.
Immunocytochemistry/Immunofluorescence: WNK1 Antibody [NB600-225] - WNK1 antibody was tested in HEK293 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Western Blot: GRASP65 Antibody (5G8) [NBP2-02665] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GRASP65 monoclonal antibody.
Immunocytochemistry: GRASP65 Antibody (5G8) [NBP2-02665] - Golgi localization in human Wi26 cells. Works for ICC on MeOH and PFA-fixed cells 1:100-1:200 dilution WB on human lung fibroblasts 1:2000 in TBST (membrane blocking with 5% skimmed milk). This image was submitted via customer Review.
Immunohistochemistry-Paraffin: GRASP65 Antibody (5G8) [NBP2-02665] - Staining of paraffin-embedded Human prostate tissue using anti-GRASP65 mouse monoclonal antibody.
(3 Reviews)
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Western Blot: ASCC1 Antibody (6G5) [NBP2-01345] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC1.
Immunocytochemistry/Immunofluorescence: ASCC1 Antibody (6G5) [NBP2-01345] Staining of COS7 cells transiently transfected by pCMV6-ENTRY ASCC1.
Immunohistochemistry-Paraffin: ASCC1 Antibody (6G5) [NBP2-01345] - Staining of paraffin-embedded Human tonsil using anti-ASCC1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Synaptotagmin-1
Antibody
NBP1-91499
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Synaptotagmin 1 in bovine oocytes. Image from confirmed customer review.
Immunocytochemistry/Immunofluorescence: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary Dilution: 1:200, Image Submitted by: David Zenisek, Yale University.
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%
(1 Review)
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
Serum Response
Factor SRF Antibody
NBP1-33063
Western Blot: Serum Response Factor SRF Antibody [NBP1-33063] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE, antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: Serum Response Factor SRF Antibody [NBP1-33063] - Paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Serum Response Factor SRF Antibody [NBP1-33063] - Detects SRF protein at nucleus on paraffin-embedded mouse lung tissue at a dilution of 1:500.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and pancreas tissues using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
AKR1B1 Antibody
NBP1-89146
Western Blot: AKR1B1 Antibody [NBP1-89146] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ASC1 Antibody
NBP1-89656
ASC1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ASC1 Antibody (NBP1-89656)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ASC1 Antibody (NBP1-89656) (0)

There are no reviews for ASC1 Antibody (NBP1-89656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASC1 Antibody (NBP1-89656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASC1 Products

Bioinformatics Tool for ASC1 Antibody (NBP1-89656)

Discover related pathways, diseases and genes to ASC1 Antibody (NBP1-89656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASC1 Antibody (NBP1-89656)

Discover more about diseases related to ASC1 Antibody (NBP1-89656).
 

Pathways for ASC1 Antibody (NBP1-89656)

View related products by pathway.

Research Areas for ASC1 Antibody (NBP1-89656)

Find related products by research area.

Blogs on ASC1

There are no specific blogs for ASC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIP4