Home » ASC1 » ASC1 Antibodies » ASC1 Antibody

ASC1 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ASC1 Antibody [NBP1-89656] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASC1 Protein (NBP1-89656PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-89656 in the following applications:
Publications
Read Publication using
NBP1-89656 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASC1 Antibody

  • activating signal cointegrator 1
  • ASC-1
  • HsT17391
  • thyroid hormone receptor interactor 4
  • thyroid receptor interacting protein 4
  • Thyroid receptor-interacting protein 4
  • TR-interacting protein 4
  • TRIP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASC/TMS1 Antibody
- BSA Free
NBP1-78977
Immunocytochemistry/Immunofluorescence: ASC/TMS1 Antibody [NBP1-78977] - Tested in MCF-7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunocytochemistry/Immunofluorescence: ASC/TMS1 Antibody [NBP1-78977] - NLRP3 activation was evaluated by visualizing the co-localization of NLRP3 and apoptosis-associated speck-like protein (ASC) using immunocytochemistry (A). PLoS One. 2020 Jun 17;15(6):e0234039. doi: 10.1371/journal.pone.0234039. (Catalog # NBP1-78977AF647)
Immunohistochemistry: ASC/TMS1 Antibody [NBP1-78977] - Rats were infected by S. pneumoniae or given PBS sham control. 21.5 umoles/kg Mito-Vit-E (MVE) or vehicle was administered orally 30 minutes post-inoculation, and heart tissues were harvested 24 hours later. Heart sections were co-stained with anti-ASC (brown) and haematoxylin (blue). Negative control was stained with secondary antibody alone. Images are representative of a random selection of at least 3 sections of N = 6. PLoS One. 2015 Oct 8;10(10):e0139416. doi: 10.1371/journal.pone.0139416.
(2 Reviews)
(29 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
RACK1/GNB2L1
Antibody (OTI2D8)
NBP2-00612
Flow Cytometry: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - Analysis of Hela cells, using anti-GNB2L1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GNB2L1 antibody, and then analyzed by flow cytometry.
Immunohistochemistry-Paraffin: RACK1/GNB2L1 Antibody (2D8) [NBP2-00612] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-GNB2L1 mouse monoclonal antibody.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
SLC7A10 Antibody
NBP3-12252
Immunohistochemistry-Paraffin: SLC7A10 Antibody [NBP3-12252] - Mouse Brain- NBP3-12252. 1:50 dilution inIHC Blocking Buffer. DAB (brown) straining and Hematoxylin QS (blue) counterstrain. 40x magnification. FFPE section.
Western Blot: SLC7A10 Antibody [NBP3-12252] - WB of NBP3-12252 with SKNMC cells. 1:500 antibody dilution in DiluObuffer.
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
CD98 Antibody
(1C11.7E3) - Azide an ...
NBP2-80662
Western Blot: CD98 Antibody (1C11.7E3) - Azide and BSA Free [NBP2-80662] - Western blot analysis of human CD98 in recombinant protein, A431, Jurkat, HeLa and HepG2 lysates at 2.0 ug/ml. Image from the standard format of this antibody.
Flow (Cell Surface): CD98 Antibody (1C11.7E3) - Azide and BSA Free [NBP2-80662] - Flow cytometry analysis of human CD98 in hPBMC. Primary antibody was used at 2.5 ug / million cells. Goat anti-mouse IgG (PE) was used at 0.5 ug / million cells. The red shift line represents the primary antibody, the blue line represents the cells alone and the green line represents the isotype control. Image from the standard format of this antibody.
Immunohistochemistry-Paraffin: CD98 Antibody (1C11.7E3) - Azide and BSA Free [NBP2-80662] - IHC analysis of formalin-fixed paraffin-embedded tissue section of human kidney using CD98 antibody (clone 1C11.7E3) at 1:300 dilution. The antibody generated a distinct/intense membranous staining with relatively weaker cytoplasmic signal, and the immuno
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
SLC1A5 Antibody
NBP1-89327
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.
(1 Review)
(3 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - mouse cortex - postnatal brain was stained with anti-CUTL1 antibody. Image from verified customer review.
ELISA: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Detection limit for recombinant GST tagged CUTL1 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
(89 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
WNK1 Antibody
[Unconjugated]
AF2849
Western blot shows lysates of DA3 mouse myeloma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Mouse/Rat WNK1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2849) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for WNK1 at approximately 230 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu, Rt
Applications: WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/Immunofluorescence: GRASP65 Antibody (OTI5G8) [NBP2-02665] - Detection in cultured pig trabecular meshwork cells. Image from a verified customer review.
Immunocytochemistry/Immunofluorescence: GRASP65 Antibody (OTI5G8) [NBP2-02665] - Staining in Hela cells: red CFTR, Green GRASP65 and Blue is DAPI. Image from a verified customer review.
Flow Cytometry: GRASP65 Antibody (5G8) [NBP2-02665] - Analysis of Jurkat cells, using anti-GRASP65 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Flow Cytometry: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - Analysis of Jurkat cells, using anti-ASCC1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-ASCC1 antibody, and then analyzed by Flow cytometry.
Western Blot: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC1.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Synaptotagmin 1
Antibody
NBP1-91499
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%
Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: complete mouse retina sections. Red: Primary. Blue: DAPI. Primary Dilution: 1:200. Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L). Secondary Dilution: 1:200. Image Submitted by: David Zenisek. Yale University
Immunocytochemistry/Immunofluorescence: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary Dilution: 1:200, Image Submitted by: David Zenisek, Yale University.
(1 Review)
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Serum Response
Factor SRF Antibody ( ...
NBP3-13785
Flow Cytometry: Serum Response Factor SRF Antibody (PCRP-SRF-1F7) [NBP3-13785] - Flow cytometric analysis of PFA-fixed HeLa cells. Serum Response Factor SRF antibody (PCRP-SRF-1F7) followed by goat anti-mouse IgG-CF488 (blue); isotype control (red).
Immunocytochemistry/Immunofluorescence: Serum Response Factor SRF Antibody (PCRP-SRF-1F7) [NBP3-13785] - Immunofluorescence Analysis of PFA-fixed HeLa cells stained using Serum Response Factor SRF Antibody (PCRP-SRF-1F7) followed by goat anti-mouse IgG-CF488 (green). CF640R phalloidin (red).
Protein Array: Serum Response Factor SRF Antibody (PCRP-SRF-1F7) [NBP3-13785] - Analysis of Protein Array containing more than 19,000 full-length human proteins using Serum Response Factor SRF Antibody (PCRP-SRF-1F7).
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Species: Hu
Applications: IHC, IHC-P, KD, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ASC1 Antibody
NBP1-89656
ASC1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ASC1 Antibody (NBP1-89656)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for ASC1 Antibody (NBP1-89656) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89656:
Filter by Applications
We used a ProSieve QuadColor Protein Markers (Cat.NO.: 00193837) Lonza
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Other ASC1 NBP1-89656
Enlarge 		4
reviewed by:
Margherita verardo
 We used a ProSieve QuadColor Protein Markers (Cat.NO.: 00193837) Lonza Human 07/13/2020
View

Summary

ApplicationOther
Sample TestedSkeletal muscle
SpeciesHuman
LotA107250

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASC1 Antibody (NBP1-89656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASC1 Products

Bioinformatics Tool for ASC1 Antibody (NBP1-89656)

Discover related pathways, diseases and genes to ASC1 Antibody (NBP1-89656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASC1 Antibody (NBP1-89656)

Discover more about diseases related to ASC1 Antibody (NBP1-89656).
 

Pathways for ASC1 Antibody (NBP1-89656)

View related products by pathway.

Research Areas for ASC1 Antibody (NBP1-89656)

Find related products by research area.

Blogs on ASC1

There are no specific blogs for ASC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Other ASC1 NBP1-89656
Enlarge
 Margherita verardo
07/13/2020
Application: We used a ProSieve QuadColor Protein Markers (Cat.NO.: 00193837) Lonza
Species: Human
read this review

Bioinformatics

Gene Symbol TRIP4