ASC1 Antibody

Images

 
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ASC1 Antibody [NBP1-89656] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA
Specificity
Specificity of human, mouse, rat ASC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASC1 Protein (NBP1-89656PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-89656 in the following applications:

Publications
Read Publication using
NBP1-89656 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASC1 Antibody

  • activating signal cointegrator 1
  • ASC-1
  • HsT17391
  • thyroid hormone receptor interactor 4
  • thyroid receptor interacting protein 4
  • Thyroid receptor-interacting protein 4
  • TR-interacting protein 4
  • TRIP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IM, IP
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-38816
Species: Hu
Applications: IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP1-89327
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB4364
Species: Rt
Applications: WB, IHC, IP, ICC
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ASC1 Antibody (NBP1-89656)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for ASC1 Antibody (NBP1-89656) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89656:
Filter by Applications
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 ASC1 NBP1-89656
Enlarge
4
reviewed by:
Anonymous
Human 07/13/2020
View

Summary

Sample TestedSkeletal muscle
SpeciesHuman
LotA107250

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASC1 Antibody (NBP1-89656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ASC1 Products

Bioinformatics Tool for ASC1 Antibody (NBP1-89656)

Discover related pathways, diseases and genes to ASC1 Antibody (NBP1-89656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASC1 Antibody (NBP1-89656)

Discover more about diseases related to ASC1 Antibody (NBP1-89656).
 

Pathways for ASC1 Antibody (NBP1-89656)

View related products by pathway.

Research Areas for ASC1 Antibody (NBP1-89656)

Find related products by research area.

Blogs on ASC1

There are no specific blogs for ASC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
07/13/2020
Application:
Species: Human

Bioinformatics

Gene Symbol TRIP4