LANCL2 Antibody - BSA Free

Western Blot: LANCL2 Antibody [NBP1-83340] - Analysis in human cell line A-431 and human cell line SK-MEL-30.

Analysis in control (vector only transfected HEK293T lysate) and LANCL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LANCL2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LANCL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LANCL2 Protein (NBP1-83340PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LANCL2 Antibody - BSA Free

• G protein-coupled receptor 69B
• GPR69B
• LanC (bacterial lantibiotic synthetase component C)-like 2
• LanC lantibiotic synthetase component C-like 2 (bacterial)
• LANCL2
• lanC-like protein 2
• TASP
• TASPMGC87139
• Testis-specific adriamycin sensitivity protein

Background

Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LANCL2