Laminin beta 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Laminin beta 1 Antibody [NBP1-88074] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Laminin beta 1 Antibody [NBP1-88074] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Laminin beta 1 Antibody [NBP1-88074] - Staining of human tonsil shows no cytoplasmic positivity in non-germinal center cells as expected.

Staining of human placenta show strong cytoplasmic positivity in trophoblastic cells.

Analysis in human cell line WM-115.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Laminin beta 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Laminin beta 1 Antibody - BSA Free (NBP1-88074) is a polyclonal antibody validated for use in IHC and WB. Anti-Laminin beta 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAMB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Laminin beta 1 Protein (NBP1-88074PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22093360). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Laminin beta 1 Antibody - BSA Free

• CLM
• cutis laxa with marfanoid phenotype
• Laminin B1 chain
• laminin subunit beta-1
• laminin, beta 1
• Laminin-1 subunit beta
• Laminin-10 subunit beta
• Laminin-12 subunit beta
• Laminin-2 subunit beta
• Laminin-6 subunit beta
• Laminin-8 subunit beta
• MGC142015

Background

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing type IV collagen networks, nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble and bind to other matrix macromolecules, and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Laminin beta 1 Antibody (NBP1-88074)(1)

Publication using NBP1-88074

• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: LAMB1