Laminin alpha 3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Laminin alpha 3 Antibody [NBP1-89955] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Analysis in human small intestine and tonsil tissues using NBP1-89955 antibody. Corresponding LAMA3 RNA-seq data are presented for the same tissues.

Staining of human small intestine shows moderate positivity in basement membrane of glandular cells.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Staining of human skin shows moderate positivity in basement membrane of epithelial cells.

Staining of human prostate shows weak to moderate positivity in basement membrane of glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Laminin alpha 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Laminin alpha 3 Antibody - BSA Free (NBP1-89955) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Laminin alpha 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAMA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF: Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Laminin alpha 3 Protein (NBP1-89955PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22892598)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Laminin alpha 3 Antibody - BSA Free

• BM600 150kD subunit
• BM600
• BM600-150kDa
• E170
• Epiligrin 170 kDa subunit
• epiligrin alpha 3 subunit
• Epiligrin subunit alpha
• epiligrin
• kalinin 165kD subunit
• Kalinin subunit alpha
• kalinin-165kDa
• lama3a
• laminin subunit alpha-3
• laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin)
• laminin, alpha 3
• laminin-5 alpha 3 chain
• Laminin-5 subunit alpha
• Laminin-6 subunit alpha
• Laminin-7 subunit alpha
• LAMNA
• LOCS
• nicein 150kD subunit
• Nicein subunit alpha
• nicein-150kDa

Background

Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Laminin alpha 3 Antibody (NBP1-89955)(1)

Publication using NBP1-89955

• Kuhn E, Kurman RJ, Soslow R et al. The diagnostic and biological implications of laminin expression in serous tubal intraepithelial carcinoma. Am J Surg Pathol 2012-12-01 [PMID: 22892598]

Bioinformatics

• Gene Symbol: LAMA3