Laminin alpha 3 Antibody

Images

 
Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody [NBP1-89955] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Laminin alpha 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Laminin alpha 3 Protein (NBP1-89955PEP)
Publications
Read Publication using NBP1-89955.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22892598)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Laminin alpha 3 Antibody

  • BM600 150kD subunit
  • BM600
  • BM600-150kDa
  • E170
  • Epiligrin 170 kDa subunit
  • epiligrin alpha 3 subunit
  • Epiligrin subunit alpha
  • epiligrin
  • kalinin 165kD subunit
  • Kalinin subunit alpha
  • kalinin-165kDa
  • lama3a
  • laminin subunit alpha-3
  • laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin)
  • laminin, alpha 3
  • laminin-5 alpha 3 chain
  • Laminin-5 subunit alpha
  • Laminin-6 subunit alpha
  • Laminin-7 subunit alpha
  • LAMNA
  • LOCS
  • nicein 150kD subunit
  • Nicein subunit alpha
  • nicein-150kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46622
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-40561
Species: Hu
Applications: WB, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-45825
Species: Hu
Applications: WB, IHC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-46231
Species: Hu
Applications: WB, IHC

Publications for Laminin alpha 3 Antibody (NBP1-89955)(1)

Reviews for Laminin alpha 3 Antibody (NBP1-89955) (0)

There are no reviews for Laminin alpha 3 Antibody (NBP1-89955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Laminin alpha 3 Antibody (NBP1-89955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin alpha 3 Products

Bioinformatics Tool for Laminin alpha 3 Antibody (NBP1-89955)

Discover related pathways, diseases and genes to Laminin alpha 3 Antibody (NBP1-89955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 3 Antibody (NBP1-89955)

Discover more about diseases related to Laminin alpha 3 Antibody (NBP1-89955).
 

Pathways for Laminin alpha 3 Antibody (NBP1-89955)

View related products by pathway.

PTMs for Laminin alpha 3 Antibody (NBP1-89955)

Learn more about PTMs related to Laminin alpha 3 Antibody (NBP1-89955).
 

Research Areas for Laminin alpha 3 Antibody (NBP1-89955)

Find related products by research area.

Blogs on Laminin alpha 3

There are no specific blogs for Laminin alpha 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin alpha 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMA3