Laminin beta 3 Antibody (CL3353)

Images

 
Western Blot: Laminin beta 3 Antibody (3353) [NBP2-46622] - Analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
Immunocytochemistry/ Immunofluorescence: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of A-431 cells using the Anti-LAMB3 monoclonal antibody, showing specific staining in the endoplasmic reticulum in ...read more
Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (3353) [NBP2-46622] - Staining or rat kidney shows immunoreactivity in renal glomerulus.
Western Blot: Laminin beta 3 Antibody (3353) [NBP2-46622] - Analysis in human lung tissue
Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (3353) [NBP2-46622] - Staining of human prostate shows immunoreactivity in basement membrane of glandular epithelium.
Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (3353) [NBP2-46622] - Staining of human urinary bladder wall shows positivity in basement membrane of squamous epithelium.
Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (3353) [NBP2-46622] - Staining of human fallopian tube shows immunoreactivity in basement membrane of glandular epithelium.
Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (3353) [NBP2-46622] - Staining of human tonsil shows absence of immunoreactivity in lymphoid tissue (negative control).
Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (3353) [NBP2-46622] - Staining or rat rectum shows immunoreactivity in basement membrane of glandular epithelium and in blood vessels.
Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (3353) [NBP2-46622] - Staining or rat lung shows positivity in basement membrane of respiratory epithelium.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL3353
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Laminin beta 3 Antibody (CL3353) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS mlGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI mlRSADLTGLEKRVEQ
Epitope
ASEQALSAQEGFERI
Specificity
Specificity of human Laminin beta 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
LAMB3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control
Laminin beta 3 Knockout HeLa Cell Lysate
Laminin beta 3 Knockout HeLa Cell Lysate
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP2-46622 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Laminin beta 3 Antibody (CL3353)

  • BM600-125kDa
  • Epiligrin subunit bata
  • FLJ99565
  • Kalinin B1 chain
  • Kalinin subunit beta
  • kalinin-140kDa
  • LAM5
  • Laminin 5
  • Laminin B1k chain
  • laminin S B3 chain
  • laminin subunit beta-3
  • laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD))
  • laminin, beta 3
  • Laminin-5 subunit beta
  • LAMNB1
  • Nicein subunit beta
  • nicein-125kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB21441
Species: Hu
Applications: WB, IHC, IP, ICC, ICFlow
AF3837
Species: Mu
Applications: WB, IHC
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2728
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30604
Species: Hu
Applications: IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NBP1-86061
Species: Hu
Applications: IHC, IHC-P
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90312
Species: Hu
Applications: IHC, IHC-P

Publications for Laminin beta 3 Antibody (NBP2-46622) (0)

There are no publications for Laminin beta 3 Antibody (NBP2-46622).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Laminin beta 3 Antibody (NBP2-46622) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rabbit.

Reviews using NBP2-46622:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Rabbit
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Apu Saikia
ICC Rabbit 05/04/2018
View

Summary

ApplicationImmunocytochemistry
Sample TestedRabbit tissue
SpeciesRabbit
Lot02999

Comments

Comments1 hour incubation at 1:500 dilution worked very well for immunohistochemistry

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Laminin beta 3 Antibody (NBP2-46622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Laminin beta 3 Products

Bioinformatics Tool for Laminin beta 3 Antibody (NBP2-46622)

Discover related pathways, diseases and genes to Laminin beta 3 Antibody (NBP2-46622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin beta 3 Antibody (NBP2-46622)

Discover more about diseases related to Laminin beta 3 Antibody (NBP2-46622).
 

Pathways for Laminin beta 3 Antibody (NBP2-46622)

View related products by pathway.

PTMs for Laminin beta 3 Antibody (NBP2-46622)

Learn more about PTMs related to Laminin beta 3 Antibody (NBP2-46622).

Blogs on Laminin beta 3

There are no specific blogs for Laminin beta 3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Apu Saikia
05/04/2018
Application: ICC
Species: Rabbit

Bioinformatics

Gene Symbol LAMB3
Entrez
Uniprot
Novus 100% Guarantee