Laminin alpha 2 Antibody (CL3450)

Images

 
Western Blot: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Analysis of purified human recombinant Laminin-211, Laminin-221, Laminin-332, Laminin-421, Laminin-511 and Laminin-121.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining in human heart muscle and tonsil tissues. Corresponding LAMA2 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining of mouse heart muscle shows strong membranous positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining of rat stomach shows strong positivity in basement membrane of glandular cells.
Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining of rat heart muscle shows strong membranous positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining of human heart muscle shows strong membranous positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining of human placenta shows moderate positivity in basement membrane of trophoblastic cells.
Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining of human cerebral cortex shows moderate positivity in blood vessels.
Immunohistochemistry-Paraffin: Laminin alpha 2 Antibody (3450) [NBP2-46624] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL3450
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Laminin alpha 2 Antibody (CL3450) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT
Epitope
DKLKPIKELEDNLKK
Specificity
Specificity of human Laminin alpha 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
LAMA2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Laminin alpha 2 Recombinant Protein Antigen (NBP2-46624PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Laminin alpha 2 Antibody (CL3450)

  • LAMA2
  • Laminin alpha 2
  • Laminin M chain
  • laminin subunit alpha-2
  • laminin, alpha 2
  • Laminin-12 subunit alpha
  • Laminin-2 subunit alpha
  • LAMM
  • LAMMLaminin-4 subunit alpha
  • Merosin heavy chain
  • Merosin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-144
Species: Hu, Mu, Rt, ChHa, In, Ma, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP3-04945
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-66814
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
AF3837
Species: Mu
Applications: WB, IHC
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94712
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
MAB5285
Species: Hu
Applications: WB, Simple Western
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46624
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Laminin alpha 2 Antibody (NBP2-46624) (0)

There are no publications for Laminin alpha 2 Antibody (NBP2-46624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin alpha 2 Antibody (NBP2-46624) (0)

There are no reviews for Laminin alpha 2 Antibody (NBP2-46624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin alpha 2 Antibody (NBP2-46624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Laminin alpha 2 Products

Bioinformatics Tool for Laminin alpha 2 Antibody (NBP2-46624)

Discover related pathways, diseases and genes to Laminin alpha 2 Antibody (NBP2-46624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 2 Antibody (NBP2-46624)

Discover more about diseases related to Laminin alpha 2 Antibody (NBP2-46624).
 

Pathways for Laminin alpha 2 Antibody (NBP2-46624)

View related products by pathway.

PTMs for Laminin alpha 2 Antibody (NBP2-46624)

Learn more about PTMs related to Laminin alpha 2 Antibody (NBP2-46624).

Blogs on Laminin alpha 2

There are no specific blogs for Laminin alpha 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin alpha 2 Antibody (CL3450) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMA2
Entrez
Uniprot