Lambda5/IGLL1 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to IGLL1(immunoglobulin lambda-like polypeptide 1) The peptide sequence was selected from the N terminal of IGLL1.
Peptide sequence RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IGLL1 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for Lambda5/IGLL1 Antibody - BSA Free
Background
The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made.The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. This gene encodes one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. This gene does not undergo rearrangement. Mutations in this gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. Two transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, Flow, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Mu
Applications: ChIP, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, IHC, ICFlow, Neut, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: WB
Publications for Lambda5/IGLL1 Antibody (NBP1-58333) (0)
There are no publications for Lambda5/IGLL1 Antibody (NBP1-58333).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lambda5/IGLL1 Antibody (NBP1-58333) (0)
There are no reviews for Lambda5/IGLL1 Antibody (NBP1-58333).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lambda5/IGLL1 Antibody (NBP1-58333) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lambda5/IGLL1 Products
Research Areas for Lambda5/IGLL1 Antibody (NBP1-58333)
Find related products by research area.
|
Blogs on Lambda5/IGLL1