Lactoperoxidase Recombinant Protein Antigen

Images

 
There are currently no images for Lactoperoxidase Protein (NBP1-87010PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lactoperoxidase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LPO.

Source: E. coli

Amino Acid Sequence: IVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LPO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87010.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lactoperoxidase Recombinant Protein Antigen

  • EC 1.11.1
  • lactoperoxidase
  • MGC129990
  • MGC129991
  • Salivary peroxidase
  • SAPX
  • SPOEC 1.11.1.7

Background

Lactoperoxidase is an antibacterial agent in cow milk. The heme protein lactoperoxidase (LPO), also referred to as salivary peroxidase (SPO), is an oxidoreductase secreted into milk. LPO belongs to the XPO subfamily of the peroxidase family. It is expressed in mammary and salivary glands, and in the presence of H2O2, LPO acts as a catalyst for the oxidation of many phenols and aromatic amines. It is crucial for protecting the lactating mammary gland and intestinal tract of newborn infants against microorganisms. LPO binds one calcium ion per heterodimer and one heme B (iron-protoporphyrin IX) group covalently per heterodimer. The LPO gene, which spans 28 kb, is similar in gene organization and sequence to the peroxidase genes MPO and EPX, suggesting the possibility that these genes evolved from a common ancestral gene. The LPO and MPO genes are arranged in a tail-to-tail manner on chromosome 17q23.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP3-45895
Species: Hu, Mu
Applications: ELISA, IHC, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP1-80670
Species: Hu
Applications: IHC, IHC-P, WB
NB120-10109
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87010PEP
Species: Hu
Applications: AC

Publications for Lactoperoxidase Protein (NBP1-87010PEP) (0)

There are no publications for Lactoperoxidase Protein (NBP1-87010PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactoperoxidase Protein (NBP1-87010PEP) (0)

There are no reviews for Lactoperoxidase Protein (NBP1-87010PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lactoperoxidase Protein (NBP1-87010PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lactoperoxidase Products

Research Areas for Lactoperoxidase Protein (NBP1-87010PEP)

Find related products by research area.

Blogs on Lactoperoxidase

There are no specific blogs for Lactoperoxidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lactoperoxidase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LPO