Kv6.4 Antibody - BSA Free

Staining of human cell line HeLa shows localization to plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kv6.4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kv6.4 Antibody - BSA Free (NBP3-24947) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Kv6.4 using the following amino acid sequence: RKLLRKLEELEELAKLHREDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNG4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kv6.4 Antibody - BSA Free

• KV6.3
• KV6.4
• MGC129609
• potassium voltage-gated channel, subfamily G, member 4
• voltage-gated potassium channel Kv6.3
• voltage-gated potassium channel subunit Kv6.4

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as amodulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been foundin normal and cancerous tissues. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNG4