Kv8.2 Antibody

Images

 
Immunohistochemistry-Paraffin: Kv8.2 Antibody [NBP1-82860] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv8.2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNV2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv8.2 Protein (NBP1-82860PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv8.2 Antibody

  • KV11.1
  • Kv8.2
  • MGC120515
  • potassium channel, subfamily V, member 2
  • potassium voltage-gated channel subfamily V member 2
  • RCD3B
  • voltage-gated potassium channel Kv8.2
  • Voltage-gated potassium channel subunit Kv8.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12154
Species: Hu
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NBP1-84935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-84813
Species: Hu
Applications: IHC, IHC-P
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBL1-12155
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
640-A3
Species: Mu
NBP2-05160
Species: Hu
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19315
Species: Hu
Applications: WB
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP

Publications for Kv8.2 Antibody (NBP1-82860) (0)

There are no publications for Kv8.2 Antibody (NBP1-82860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv8.2 Antibody (NBP1-82860) (0)

There are no reviews for Kv8.2 Antibody (NBP1-82860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv8.2 Antibody (NBP1-82860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv8.2 Products

Bioinformatics Tool for Kv8.2 Antibody (NBP1-82860)

Discover related pathways, diseases and genes to Kv8.2 Antibody (NBP1-82860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv8.2 Antibody (NBP1-82860)

Discover more about diseases related to Kv8.2 Antibody (NBP1-82860).
 

Pathways for Kv8.2 Antibody (NBP1-82860)

View related products by pathway.

Blogs on Kv8.2

There are no specific blogs for Kv8.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv8.2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNV2