KCNH1 Antibody

Images

 
Immunohistochemistry-Paraffin: KCNH1 Antibody [NBP1-84935] - Staining of human lateral ventricle shows moderate cytoplasmic and nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCNH1 Protein (NBP1-84935PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNH1 Antibody

  • EAG channel 1
  • EAG1
  • EAGeag1
  • Ether-a-go-go potassium channel 1
  • ether-a-go-go, Drosophila, homolog of
  • hEAG1
  • h-eageag
  • Kv10.1
  • MGC142269
  • potassium channel, voltage-gated, subfamily H, member 1
  • potassium voltage-gated channel subfamily H member 1
  • potassium voltage-gated channel, subfamily H (eag-related), member 1
  • Voltage-gated potassium channel subunit Kv10.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12154
Species: Hu
NBP1-84934
Species: Hu
Applications: IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12155
Species: Hu
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33726
Species: Hu
Applications: IHC, IHC-P
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
H00006192-P01
Species: Hu
NBP1-84935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KCNH1 Antibody (NBP1-84935) (0)

There are no publications for KCNH1 Antibody (NBP1-84935).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNH1 Antibody (NBP1-84935) (0)

There are no reviews for KCNH1 Antibody (NBP1-84935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNH1 Antibody (NBP1-84935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNH1 Products

Bioinformatics Tool for KCNH1 Antibody (NBP1-84935)

Discover related pathways, diseases and genes to KCNH1 Antibody (NBP1-84935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNH1 Antibody (NBP1-84935)

Discover more about diseases related to KCNH1 Antibody (NBP1-84935).
 

Pathways for KCNH1 Antibody (NBP1-84935)

View related products by pathway.

PTMs for KCNH1 Antibody (NBP1-84935)

Learn more about PTMs related to KCNH1 Antibody (NBP1-84935).

Blogs on KCNH1

There are no specific blogs for KCNH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNH1