Kv12.2 Antibody


Immunocytochemistry/ Immunofluorescence: Kv12.2 Antibody [NBP2-14142] - Staining of human cell line A549 shows localization to nucleus & mitochondria.
Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Kv12.2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSS SSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
Specificity of human Kv12.2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Kv12.2 Protein (NBP2-14142PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kv12.2 Antibody

  • BEC1
  • brain-specific eag-like channel 1
  • ELK channel 2
  • ELK2
  • ether-a-go-go K(+) channel family member
  • ether-a-go-go-like potassium channel 2
  • KIAA1282
  • Kv12.2
  • potassium voltage-gated channel subfamily H member 3
  • potassium voltage-gated channel, subfamily H (eag-related), member 3
  • voltage-gated potassium channel subunit Kv12.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, RNAi
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Kv12.2 Antibody (NBP2-14142) (0)

There are no publications for Kv12.2 Antibody (NBP2-14142).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv12.2 Antibody (NBP2-14142) (0)

There are no reviews for Kv12.2 Antibody (NBP2-14142). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Kv12.2 Antibody (NBP2-14142). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in your Kv12.2 antibody, but I see on your website that the only image is IHC of human kidney (and this was using NBP2-14142). I was wondering whether you have any images using brain tissue/brain lysate, as well as any images using NBP1-30641, as I am also interesting in running westerns with the antibody. Additionally, do you have a control peptide and Kv12.2 over-expressing lysate for the antibody?
    • NBP1-14142 has only been validated in IHC on paraffin-embedded tissues and has not been tested for its use in Western blot. NBP1-30641 has been validated in Western blot and IHC on both frozen and paraffin-embedded tissues. We do not currently have any images for this but this product is 100% guaranteed for the applications and species listed on the datasheet. We do not currently have a positive control lysate for this target.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Kv12.2 Antibody (NBP2-14142)

Discover related pathways, diseases and genes to Kv12.2 Antibody (NBP2-14142). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv12.2 Antibody (NBP2-14142)

Discover more about diseases related to Kv12.2 Antibody (NBP2-14142).

Pathways for Kv12.2 Antibody (NBP2-14142)

View related products by pathway.

PTMs for Kv12.2 Antibody (NBP2-14142)

Learn more about PTMs related to Kv12.2 Antibody (NBP2-14142).

Blogs on Kv12.2

There are no specific blogs for Kv12.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kv12.2 Antibody and receive a gift card or discount.


Gene Symbol KCNH3