Kv12.2 Antibody

Immunocytochemistry/Immunofluorescence: Kv12.2 Antibody [NBP2-14142] - Staining of human cell line A549 shows localization to nucleus & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Kv12.2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
• Predicted Species: Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNH3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Kv12.2 Protein (NBP2-14142PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kv12.2 Antibody

• BEC1
• brain-specific eag-like channel 1
• ELK channel 2
• ELK2
• ether-a-go-go K(+) channel family member
• ether-a-go-go-like potassium channel 2
• KIAA1282
• Kv12.2
• potassium voltage-gated channel subfamily H member 3
• potassium voltage-gated channel, subfamily H (eag-related), member 3
• voltage-gated potassium channel subunit Kv12.2

Background

Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Kv12.2 Antibody (NBP2-14142). (Showing 1 - 1 of 1 FAQ).

1. I am interested in your Kv12.2 antibody, but I see on your website that the only image is IHC of human kidney (and this was using NBP2-14142). I was wondering whether you have any images using brain tissue/brain lysate, as well as any images using NBP1-30641, as I am also interesting in running westerns with the antibody. Additionally, do you have a control peptide and Kv12.2 over-expressing lysate for the antibody?
   • NBP1-14142 has only been validated in IHC on paraffin-embedded tissues and has not been tested for its use in Western blot. NBP1-30641 has been validated in Western blot and IHC on both frozen and paraffin-embedded tissues. We do not currently have any images for this but this product is 100% guaranteed for the applications and species listed on the datasheet. We do not currently have a positive control lysate for this target.

Bioinformatics

• Gene Symbol: KCNH3