Kv11.3 Antibody

Images

 
Immunohistochemistry-Paraffin: Kv11.3 Antibody [NBP1-84813] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv11.3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DNCKLRRRKLSFESEGEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIGKASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNH7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv11.3 Protein (NBP1-84813PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv11.3 Antibody

  • Eag-related protein 3
  • ERG-3
  • ERG3eag related protein 3
  • ether-a-go-go related gene potassium channel 3
  • Ether-a-go-go-related gene potassium channel 3
  • Ether-a-go-go-related protein 3
  • hERG-3
  • HERG3erg3
  • Kv11.3MGC45986
  • potassium channel subunit HERG-3
  • potassium voltage-gated channel subfamily H member 7
  • potassium voltage-gated channel, subfamily H (eag-related), member 7
  • Voltage-gated potassium channel subunit Kv11.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12154
Species: Hu
NBL1-12155
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-59450
Species: Hu
Applications: WB
NBP1-84935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55973
Species: Hu
Applications: WB, ICC/IF
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-74102
Species: Mu, ChHa
Applications: WB
NBP1-84813
Species: Hu
Applications: IHC, IHC-P

Publications for Kv11.3 Antibody (NBP1-84813) (0)

There are no publications for Kv11.3 Antibody (NBP1-84813).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv11.3 Antibody (NBP1-84813) (0)

There are no reviews for Kv11.3 Antibody (NBP1-84813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv11.3 Antibody (NBP1-84813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv11.3 Products

Bioinformatics Tool for Kv11.3 Antibody (NBP1-84813)

Discover related pathways, diseases and genes to Kv11.3 Antibody (NBP1-84813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv11.3 Antibody (NBP1-84813)

Discover more about diseases related to Kv11.3 Antibody (NBP1-84813).
 

Pathways for Kv11.3 Antibody (NBP1-84813)

View related products by pathway.

PTMs for Kv11.3 Antibody (NBP1-84813)

Learn more about PTMs related to Kv11.3 Antibody (NBP1-84813).

Blogs on Kv11.3

There are no specific blogs for Kv11.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv11.3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNH7