Kv7.3 Antibody

Images

 
Western Blot: Kv7.3 Antibody [NBP1-74102] - Lanes: 100 ug CHO cell lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1 : 25000 Gene name: Kcnq3 Submitted ...read more
Western Blot: Kv7.3 Antibody [NBP1-74102] - Kv7.3 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Product Details

Summary
Reactivity Mu, ChHaSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv7.3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Kv7.3. Immunizing peptide sequence TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNQ3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Kcnq3 and was validated on Western blot.
Publications
Read Publication using NBP1-74102.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kv7.3 Antibody

  • BFNC2
  • EBN2
  • KQT-like 3
  • Kv7.3
  • Potassium channel subunit alpha KvLQT3
  • potassium channel, voltage-gated, subfamily Q, member 3
  • potassium voltage-gated channel subfamily KQT member 3
  • potassium voltage-gated channel, KQT-like subfamily, member 3
  • Voltage-gated potassium channel subunit Kv7.3

Background

Kv7.3 is probably important in the regulation of neuronal excitability. It associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82861
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-58876
Species: Hu
Applications: ICC/IF
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP2-04663
Species: Hu
NBL1-12154
Species: Hu
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
H00006326-Q01
Species: Hu
AF1396
Species: Hu
Applications: WB
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NB300-190
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-74102
Species: Mu, ChHa
Applications: WB

Publications for Kv7.3 Antibody (NBP1-74102)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Kv7.3 Antibody (NBP1-74102) (0)

There are no reviews for Kv7.3 Antibody (NBP1-74102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv7.3 Antibody (NBP1-74102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv7.3 Products

Bioinformatics Tool for Kv7.3 Antibody (NBP1-74102)

Discover related pathways, diseases and genes to Kv7.3 Antibody (NBP1-74102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv7.3 Antibody (NBP1-74102)

Discover more about diseases related to Kv7.3 Antibody (NBP1-74102).
 

Pathways for Kv7.3 Antibody (NBP1-74102)

View related products by pathway.

PTMs for Kv7.3 Antibody (NBP1-74102)

Learn more about PTMs related to Kv7.3 Antibody (NBP1-74102).

Blogs on Kv7.3

There are no specific blogs for Kv7.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv7.3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNQ3
Uniprot