Reactivity | Mu, HaSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to the middle region of Kv7.3. Immunizing peptide sequence: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | KCNQ3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against Kcnq3 and was validated on Western blot. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS & 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-74102 | Applications | Species |
---|---|---|
Ruan Hb, Dietrich Mo, Liu Zw et al. O-GlcnAc Transferase Enables AgRP neurons to Suppress Browning of White Fat. Cell. 2014 Oct 09 [PMID: 25303527] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Diseases for Kv7.3 Antibody (NBP1-74102)Discover more about diseases related to Kv7.3 Antibody (NBP1-74102).
| Pathways for Kv7.3 Antibody (NBP1-74102)View related products by pathway.
|
PTMs for Kv7.3 Antibody (NBP1-74102)Learn more about PTMs related to Kv7.3 Antibody (NBP1-74102).
| Research Areas for Kv7.3 Antibody (NBP1-74102)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.