Home » Kv7.3 » Kv7.3 Antibodies » Kv7.3 Antibody

Kv7.3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Kv7.3 Antibody [NBP1-74102] - Lanes: 100 ug CHO cell lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1 : 25000 Gene name: Kcnq3 Submitted by: Anonymous.
Western Blot: Kv7.3 Antibody [NBP1-74102] - Lanes: 100 ug CHO cell lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1 : 25000 Gene name: Kcnq3 Submitted ...read more
Western Blot: Kv7.3 Antibody [NBP1-74102] - Kv7.3 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Product Details

Summary
Reactivity Mu, Ha, Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Kv7.3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Kv7.3. Immunizing peptide sequence: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNQ3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Kcnq3 and was validated on Western blot.
Control
Kv7.3 Knockout A549 Cell Lysate
Publications
Read Publication using NBP1-74102.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kv7.3 Antibody

  • BFNC2
  • EBN2
  • KQT-like 3
  • Kv7.3
  • Potassium channel subunit alpha KvLQT3
  • potassium channel, voltage-gated, subfamily Q, member 3
  • potassium voltage-gated channel subfamily KQT member 3
  • potassium voltage-gated channel, KQT-like subfamily, member 3
  • Voltage-gated potassium channel subunit Kv7.3

Background

Kv7.3 is probably important in the regulation of neuronal excitability. It associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kv7.2 Antibody
(S26A-23)
NBP2-12898
Western Blot: Kv7.2 Antibody (S26A-23) [NBP2-12898] - Analysis of Human, hamster HEK and CHO cell lysates showing detection of KCNQ2 protein using Mouse Anti-KCNQ2 Monoclonal Antibody, Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-KCNQ2 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT. KCNQ2 overexpressed.
Immunohistochemistry-Frozen: Kv7.2 Antibody (S26A-23) [NBP2-12898] - Tissue: frozen brain section. Species: Mouse. Fixation: 10% Formalin Solution for 12-24 hours at RT. Primary Antibody: Mouse Anti-KCNQ2 Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: HRP/DAB Detection System: Biotinylated Goat Anti-Mouse, Streptavidin Peroxidase, DAB Chromogen (brown) for 30 minutes at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 250-500 ul for 5 minutes at RT.
Immunohistochemistry: Kv7.2 Antibody (S26A-23) [NBP2-12898] - Human hippocampal tissues.
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr
Kv7.1 Antibody
(S37A-10)
NBP2-12897
Western Blot: Kv7.1 Antibody (S37A-10) [NBP2-12897] - analysis of hamster T-CHO cell lysate showing detection of KCNQ1 protein using Mouse Anti-KCNQ1 Monoclonal Antibody, Clone S37A-10. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-KCNQ1 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunohistochemistry: Kv7.1 Antibody (S37A-10) [NBP2-12897] - Tissue: hippocampus. Species: Human. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-KCNQ1 Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
Western Blot: Kv7.1 Antibody (S37A-10) [NBP2-12897] - analysis of Human Cell lysates showing detection of KCNQ1 protein using Mouse Anti-KCNQ1 Monoclonal Antibody, Clone S37A-10. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-KCNQ1 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
Kv7.5 Antibody
NBP1-82861
Immunocytochemistry/Immunofluorescence: Kv7.5 Antibody [NBP1-82861] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining in human cerebral cortex and pancreas tissues using anti-KCNQ5 antibody. Corresponding KCNQ5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Nicotinic
Acetylcholine R alpha ...
NBP2-61674
Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mAb against HEK293 (1) and CHRNA4 (AA: 29-242)-hIgGFc transfected HEK293 (2) cell lysate.
Flow Cytometry: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mouse mAb against SH-SY5Y (1) cell lysate.
Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (7B4H1) [NBP2-61674] - Analysis using CHRNA4 mAb against human CHRNA4 (AA: 29-242) recombinant protein. (Expected MW is 52.5 kDa)
Species: Hu
Applications: WB, ELISA
Kv7.4 Antibody
(S43-6)
NBP2-12899
Western Blot: Kv7.4 Antibody (S43-6) [NBP2-12899] - analysis of Rat tissue lysate showing detection of KCNQ4 protein using Mouse Anti-KCNQ4 Monoclonal Antibody, Clone S43-6. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-KCNQ4 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunohistochemistry-Frozen: Kv7.4 Antibody (S43-6) [NBP2-12899] - Tissue: frozen brain section. Species: mouse. Fixation: 10% Formalin Solution for 12-24 hours at RT. Primary Antibody: Mouse Anti-KCNQ4 Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: HRP/DAB Detection System: Biotinylated Goat Anti-Mouse, Streptavidin Peroxidase, DAB Chromogen (brown) for 30 minutes at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 250-500 ul for 5 minutes at RT.
Immunohistochemistry: Kv7.4 Antibody (S43-6) [NBP2-12899] - Tissue: hippocampus. Species: Human at 1:1000 for 1 hour.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, MiAr
Scn1a Antibody
NBP2-58876
Immunocytochemistry/Immunofluorescence: Scn1a Antibody [NBP2-58876] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
KCNE1 Antibody
(5B12)
H00003753-M01
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - Analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody (M01), clone 5B12. Lane 1: KCNE1 transfected lysate (14.7 KDa). Lane 2: Non-transfected lysate.
ELISA: KCNE1 Antibody (5B12) [H00003753-M01] - Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, RNAi
SCN1B Antibody
NBP2-94559
Western Blot: SCN1B Antibody [NBP2-94559] - Analysis of extracts of various cell lines, using SCN1B at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Kv11.1 Antibody
NBP3-03109
Western Blot: Kv11.1 Antibody [NBP3-03109] - Analysis of extracts of various cell lines, using Kv11.1 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhan
Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human lung cancer using Kv11.1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human breast cancer using Kv11.1 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Comparative proteome analysis of 3xTg-AD and control samples at different stages of AD. Immunoblot analysis of most regulated hits. Soluble fractions of brain proteins were analyzed from four 2-month-old control and 3xTg-AD mice animals, respectively. Hebp1 and Glo1 levels were consistently elevated in the transgenic animals as compared to wild type controls. Ca1 levels were reduced in transgenic animals. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/47498), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Calmodulin 2
Antibody
NBP2-14871
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Sample (50 ug of whole cell lysate) A: Mouse brain 15% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
(1 Publication)
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
Recombinant Human
SCN2A GST (N-Term) Pr ...
H00006326-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Kininogen Antibody
NBP1-89993
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human kidney using Kininogen antibody NBP1-89993.
Western Blot: Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining in human cerebral cortex and pancreas tissues using anti-CHRM1 antibody. Corresponding CHRM1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of dissociated rat hippocampal culture. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human cerebral cortex shows high expression.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Endorepellin/Perlecan/ ...
AF2364
Endorepellin/Perlecan was detected in immersion fixed paraffin-embedded sections of human skin using 5 µg/mL Goat Anti-Human Endorepellin/Perlecan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2364) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC
GABA-A R gamma 2
Antibody
NB300-151
Western Blot: GABA-A R gamma 2 Antibody [NB300-151] - 10 ug of rat brain lysate showing immunolabeling of the ~45-47 kDa GABA - A R, g2-subunit.
Immunohistochemistry-Paraffin: GABA-A R gamma 2 Antibody [NB300-151] - Rat cerebellum.
Western Blot: GABA-A R gamma 2 Antibody [NB300-151] - 10 ug of rat hippocampal lysate showing immunolabeling of the ~46k gamma2-subunit of the GABA-A R.
(7 Publications)
Species: Hu, Mu, Rt, Tr, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO

Publications for Kv7.3 Antibody (NBP1-74102)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Kv7.3 Antibody (NBP1-74102) (0)

There are no reviews for Kv7.3 Antibody (NBP1-74102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv7.3 Antibody (NBP1-74102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Kv7.3 Knockout A549 Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Kv7.3 Products

Array NBP1-74102

Bioinformatics Tool for Kv7.3 Antibody (NBP1-74102)

Discover related pathways, diseases and genes to Kv7.3 Antibody (NBP1-74102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv7.3 Antibody (NBP1-74102)

Discover more about diseases related to Kv7.3 Antibody (NBP1-74102).
 

Pathways for Kv7.3 Antibody (NBP1-74102)

View related products by pathway.

PTMs for Kv7.3 Antibody (NBP1-74102)

Learn more about PTMs related to Kv7.3 Antibody (NBP1-74102).

Blogs on Kv7.3

There are no specific blogs for Kv7.3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv7.3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KCNQ3
Uniprot