Kv7.3 Antibody


Western Blot: Kv7.3 Antibody [NBP1-74102] - Lanes: 100 ug CHO cell lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1 : 25000 Gene name: Kcnq3 Submitted ...read more
Western Blot: Kv7.3 Antibody [NBP1-74102] - Kv7.3 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Product Details

Reactivity Mu, HaSpecies Glossary
Applications WB

Order Details

Kv7.3 Antibody Summary

Synthetic peptides corresponding to the middle region of Kv7.3. Immunizing peptide sequence: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Kcnq3 and was validated on Western blot.
Read Publication using NBP1-74102.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kv7.3 Antibody

  • BFNC2
  • EBN2
  • KCNQ3
  • KQT-like 3
  • Kv7.3
  • Potassium channel subunit alpha KvLQT3
  • potassium channel, voltage-gated, subfamily Q, member 3
  • potassium voltage-gated channel subfamily KQT member 3
  • potassium voltage-gated channel, KQT-like subfamily, member 3
  • Voltage-gated potassium channel subunit Kv7.3


Kv7.3 is probably important in the regulation of neuronal excitability. It associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, MiAr, WB
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
Species: Mu, Ha
Applications: WB

Publications for Kv7.3 Antibody (NBP1-74102)(1)

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Kv7.3 Antibody (NBP1-74102) (0)

There are no reviews for Kv7.3 Antibody (NBP1-74102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv7.3 Antibody (NBP1-74102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kv7.3 Products

Array NBP1-74102

Bioinformatics Tool for Kv7.3 Antibody (NBP1-74102)

Discover related pathways, diseases and genes to Kv7.3 Antibody (NBP1-74102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv7.3 Antibody (NBP1-74102)

Discover more about diseases related to Kv7.3 Antibody (NBP1-74102).

Pathways for Kv7.3 Antibody (NBP1-74102)

View related products by pathway.

PTMs for Kv7.3 Antibody (NBP1-74102)

Learn more about PTMs related to Kv7.3 Antibody (NBP1-74102).

Research Areas for Kv7.3 Antibody (NBP1-74102)

Find related products by research area.

Blogs on Kv7.3

There are no specific blogs for Kv7.3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kv7.3 Antibody and receive a gift card or discount.


Gene Symbol KCNQ3