Ku80/XRCC5 Antibody

Images

 
Western Blot: Ku80/XRCC5 Antibody [NBP1-87829] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-306
Immunocytochemistry/ Immunofluorescence: Ku80/XRCC5 Antibody [NBP1-87829] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Ku80/XRCC5 Antibody [NBP1-87829] - Staining of human testis shows distinct nuclear positivity in germ cells and Leydig cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ku80/XRCC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRCC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ku80/XRCC5 Protein (NBP1-87829PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ku80/XRCC5 Antibody

  • 80kDa
  • ATP-dependent DNA helicase 2 subunit 2
  • ATP-dependent DNA helicase II 80 kDa subunit
  • CTC85
  • CTCBF
  • EC 3.6.4.-
  • FLJ39089
  • G22P2
  • KARP1
  • KARP-1
  • Ku80
  • Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen
  • Ku86
  • Ku86DNA repair protein XRCC5
  • KUB2
  • NFIV
  • Thyroid-lupus autoantigen
  • TLAA
  • X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit
  • X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD)
  • X-ray repair cross-complementing protein 5
  • X-ray repair, complementing defective, repair in Chinese hamster
  • XRCC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-48053
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF771
Species: Mu
Applications: WB, IHC, Neut
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-183
Species: Hu
Applications: WB
NBP1-87829
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ku80/XRCC5 Antibody (NBP1-87829) (0)

There are no publications for Ku80/XRCC5 Antibody (NBP1-87829).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ku80/XRCC5 Antibody (NBP1-87829) (0)

There are no reviews for Ku80/XRCC5 Antibody (NBP1-87829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ku80/XRCC5 Antibody (NBP1-87829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ku80/XRCC5 Products

Bioinformatics Tool for Ku80/XRCC5 Antibody (NBP1-87829)

Discover related pathways, diseases and genes to Ku80/XRCC5 Antibody (NBP1-87829). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ku80/XRCC5 Antibody (NBP1-87829)

Discover more about diseases related to Ku80/XRCC5 Antibody (NBP1-87829).
 

Pathways for Ku80/XRCC5 Antibody (NBP1-87829)

View related products by pathway.

PTMs for Ku80/XRCC5 Antibody (NBP1-87829)

Learn more about PTMs related to Ku80/XRCC5 Antibody (NBP1-87829).
 

Research Areas for Ku80/XRCC5 Antibody (NBP1-87829)

Find related products by research area.

Blogs on Ku80/XRCC5

There are no specific blogs for Ku80/XRCC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ku80/XRCC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC5
Entrez