Ku70/XRCC6 Antibody - BSA Free

Western Blot: Ku70/XRCC6 Antibody [NBP2-38954] - Analysis using Anti-XRCC6 antibody NBP2-38954 (A) shows similar pattern to independent antibody NBP2-38567 (B).

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38954] - Staining of human cerebral cortex, kidney, skin and testis using Anti-XRCC6 antibody NBP2-38954 (A) shows similar protein distribution across tissues to independent antibody NBP2-38567 (B).

Immunocytochemistry/Immunofluorescence: Ku70/XRCC6 Antibody [NBP2-38954] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38954] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38954] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38954] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38954] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ku70/XRCC6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ku70/XRCC6 Antibody - BSA Free (NBP2-38954) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Ku70/XRCC6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETR
• Predicted Species: Mouse (90%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XRCC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Ku70/XRCC6 Protein (NBP2-38954PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ku70/XRCC6 Antibody - BSA Free

• 5'-deoxyribose-5-phosphate lyase Ku70
• 5'-dRP lyase Ku70
• 70 kDa subunit of Ku antigen
• ATP-dependent DNA helicase 2 subunit 1
• ATP-dependent DNA helicase II 70 kDa subunit
• CTC box binding factor 75 kDa subunit
• CTC box-binding factor 75 kDa subunit
• CTC75
• CTCBF
• D22S731
• EC 3.6.4.-
• EC 4.2.99.-
• G22P1
• G22P1Ku70
• Ku autoantigen p70 subunit
• Ku autoantigen, 70kDa
• Ku70
• ML8
• ML8,70 kDa subunit
• thyroid-lupus autoantigen p70
• Thyroid-lupus autoantigen
• TLAA
• TLAAD22S671
• X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6
• X-ray repair cross-complementing protein 6
• XRCC6

Background

The Ku autoantigen is a heterodimer of 70kDa (p70) and ~80kDa (p80) proteins. The p70/p80 dimer is important for function of a 460kDa DNAdependent protein kinase that phosphorylates certain transcription factors, including Sp1, Oct-1, p53, and SV40 large T antigen in vitro. Ku protein plays a role in cell signaling, proliferation, DNA repair, replication, transcriptional activation, and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ku70/XRCC6 Antibody (NBP2-38954)(1)

Publication using NBP2-38954

• Og?uszka M, Chen CY, Po?awska E et Al. Elevated tissue status of omega-3 fatty acids protects against age-related telomere attrition in fat-1 transgenic mice Clin Nutr 2024-05-06 [PMID: 38718720]

Bioinformatics

• Gene Symbol: XRCC6
• Uniprot:
  • P12956()