Ku70/XRCC6 Antibody

Images

 
Western Blot: Ku70/XRCC6 Antibody [NBP2-38567] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: Ku70/XRCC6 Antibody [NBP2-38567] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38567] - Staining in human testis and liver tissues using anti-XRCC6 antibody. Corresponding XRCC6 RNA-seq data are presented for the same tissues.
Western Blot: Ku70/XRCC6 Antibody [NBP2-38567] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Western Blot: Ku70/XRCC6 Antibody [NBP2-38567] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-XRCC6 antibody. Remaining relative intensity is presented.
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38567] - Staining of human breast shows strong nuclear positivity in glandular cells and myoepithelial cells.
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38567] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP2-38567] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ku70/XRCC6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
Specificity
Specificity of human Ku70/XRCC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRCC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ku70/XRCC6 Protein (NBP2-38567PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ku70/XRCC6 Antibody

  • 5'-deoxyribose-5-phosphate lyase Ku70
  • 5'-dRP lyase Ku70
  • 70 kDa subunit of Ku antigen
  • ATP-dependent DNA helicase 2 subunit 1
  • ATP-dependent DNA helicase II 70 kDa subunit
  • CTC box binding factor 75 kDa subunit
  • CTC box-binding factor 75 kDa subunit
  • CTC75
  • CTCBF
  • D22S731
  • EC 3.6.4.-
  • EC 4.2.99.-
  • G22P1
  • G22P1Ku70
  • Ku autoantigen p70 subunit
  • Ku autoantigen, 70kDa
  • Ku70
  • ML8
  • ML8,70 kDa subunit
  • thyroid-lupus autoantigen p70
  • Thyroid-lupus autoantigen
  • TLAA
  • TLAAD22S671
  • X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6
  • X-ray repair cross-complementing protein 6
  • XRCC6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89463
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-183
Species: Hu
Applications: WB
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP2-38567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Ku70/XRCC6 Antibody (NBP2-38567) (0)

There are no publications for Ku70/XRCC6 Antibody (NBP2-38567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ku70/XRCC6 Antibody (NBP2-38567) (0)

There are no reviews for Ku70/XRCC6 Antibody (NBP2-38567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ku70/XRCC6 Antibody (NBP2-38567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Ku70/XRCC6 Antibody (NBP2-38567)

Discover related pathways, diseases and genes to Ku70/XRCC6 Antibody (NBP2-38567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ku70/XRCC6 Antibody (NBP2-38567)

Discover more about diseases related to Ku70/XRCC6 Antibody (NBP2-38567).
 

Pathways for Ku70/XRCC6 Antibody (NBP2-38567)

View related products by pathway.

PTMs for Ku70/XRCC6 Antibody (NBP2-38567)

Learn more about PTMs related to Ku70/XRCC6 Antibody (NBP2-38567).
 

Research Areas for Ku70/XRCC6 Antibody (NBP2-38567)

Find related products by research area.

Blogs on Ku70/XRCC6

There are no specific blogs for Ku70/XRCC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ku70/XRCC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC6
Entrez
Uniprot