![Western Blot: KMT2D Antibody (2E1.) [H00008085-M01] - Detection against Immunogen (36.74 KDa) .](http://images.novusbio.com/fullsize/KMT2D-Antibody-2E1-Western-Blot-H00008085-M01-img0001.jpg "Western Blot: KMT2D Antibody (2E1.) [H00008085-M01] - Detection against Immunogen (36.74 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2E1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | KMT2D |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | It has been used for ELISA. WB has been performed on the partial recombinant protein used to immunize this product. It has not yet been tested for detection of the full length protein or endogenous detection. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00008085-M01 | Applications | Species |
|---|---|---|
| Micale L, Augello B, Maffeo C et al. Molecular analysis, pathogenic mechanisms, and readthrough therapy on a large cohort of Kabuki syndrome patients. Hum Mutat. 2014-04-09 [PMID: 24633898] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
