KMT2D Antibody (2E1)

Images

 
Western Blot: KMT2D Antibody (2E1.) [H00008085-M01] - Detection against Immunogen (36.74 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KMT2D Antibody (2E1) Summary

Immunogen
MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MLL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA. WB has been performed on the partial recombinant protein used to immunize this product. It has not yet been tested for detection of the full length protein or endogenous detection.
Publications
Read Publication using H00008085-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KMT2D Antibody (2E1)

  • AAD10
  • ALRALL1-related protein
  • CAGL114
  • EC 2.1.1.43
  • histone-lysine N-methyltransferase MLL2
  • KMT2D
  • Lysine N-methyltransferase 2B
  • MLL4
  • myeloid/lymphoid or mixed-lineage leukemia 2
  • Myeloid/lymphoid or mixed-lineage leukemia protein 2
  • TNRC21
  • trinucleotide repeat containing 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57730
Species: Hu
Applications: ICC/IF
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
MAB7940
Species: Hu
Applications: WB, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80628
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92824
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-70092
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-75398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62658
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-250
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
H00008085-M01
Species: Hu
Applications: WB, ELISA

Publications for KMT2D Antibody (H00008085-M01)(1)

Reviews for KMT2D Antibody (H00008085-M01) (0)

There are no reviews for KMT2D Antibody (H00008085-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KMT2D Antibody (H00008085-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KMT2D Products

Array H00008085-M01

Bioinformatics Tool for KMT2D Antibody (H00008085-M01)

Discover related pathways, diseases and genes to KMT2D Antibody (H00008085-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KMT2D Antibody (H00008085-M01)

Discover more about diseases related to KMT2D Antibody (H00008085-M01).
 

Pathways for KMT2D Antibody (H00008085-M01)

View related products by pathway.

PTMs for KMT2D Antibody (H00008085-M01)

Learn more about PTMs related to KMT2D Antibody (H00008085-M01).

Blogs on KMT2D

There are no specific blogs for KMT2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KMT2D Antibody (2E1) and receive a gift card or discount.

Bioinformatics

Gene Symbol MLL2
Uniprot