KMT2A/MLL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KMT2A/MLL Antibody [NBP2-55237] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KMT2A/MLL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED
Specificity
Specificity of human KMT2A/MLL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KMT2A/MLL Antibody

  • ALL1
  • ALL-1MLL/GAS7
  • CXXC7TET1-MLL
  • CXXC-type zinc finger protein 7
  • EC 2.1.1.43
  • HRXFLJ11783
  • HTRX
  • HTRX1MLL-AF4 der(11) fusion protein
  • KMT2ACDK6/MLL fusion protein
  • Lysine N-methyltransferase 2A
  • MLL/GAS7 fusion protein
  • MLL/GMPS fusion protein
  • MLL1
  • MLL1A
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog)
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
  • Trithorax-like protein
  • TRX1histone-lysine N-methyltransferase MLL
  • Zinc finger protein HRX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52983
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-864
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3254
Species: Hu, Mu, Rt
Applications: WB
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-26653
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF5129
Species: Hu
Applications: WB
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP2-65123
Species: Hu
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-55237
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for KMT2A/MLL Antibody (NBP2-55237) (0)

There are no publications for KMT2A/MLL Antibody (NBP2-55237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KMT2A/MLL Antibody (NBP2-55237) (0)

There are no reviews for KMT2A/MLL Antibody (NBP2-55237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KMT2A/MLL Antibody (NBP2-55237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KMT2A/MLL Antibody (NBP2-55237)

Discover related pathways, diseases and genes to KMT2A/MLL Antibody (NBP2-55237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KMT2A/MLL Antibody (NBP2-55237)

Discover more about diseases related to KMT2A/MLL Antibody (NBP2-55237).
 

Pathways for KMT2A/MLL Antibody (NBP2-55237)

View related products by pathway.

PTMs for KMT2A/MLL Antibody (NBP2-55237)

Learn more about PTMs related to KMT2A/MLL Antibody (NBP2-55237).
 

Research Areas for KMT2A/MLL Antibody (NBP2-55237)

Find related products by research area.

Blogs on KMT2A/MLL

There are no specific blogs for KMT2A/MLL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KMT2A/MLL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLL