KLHL20 Antibody - BSA Free

Western Blot: KLHL20 Antibody [NBP1-79570] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KLHL20 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human KLHL20The immunogen for this antibody is KLHL20. Peptide sequence NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHL20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 68 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KLHL20 Antibody - BSA Free

• Kelch motif containing protein
• kelch-like 20 (Drosophila)
• kelch-like ECT2 interacting protein
• Kelch-like ECT2-interacting protein
• kelch-like protein 20
• Kelch-like protein X
• KHLHX
• KLEIP
• KLEIPRP3-383J4.3
• KLHL20
• KLHLX

Background

The protein encoded by the KLHL20 gene is a member of the kelch family of proteins, which is characterized by a 44-56 aminoacid repeat motif. The kelch motif appears in many different polypeptide contexts and contains multiple potentialprotein-protein contact sites. Members of this family are present both throughout the cell and extracellularly, withdiverse activities. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KLHL20 Antibody (NBP1-79570)(1)

Publication using NBP1-79570

• Ahmad I, Zhang J, Li R et al. Murine leukemia virus glycoGag antagonizes SERINC5 via ER-phagy receptor RETREG1 PLoS pathogens 2025-10-09 [PMID: 41066524]

Bioinformatics

• Gene Symbol: KLHL20
• Uniprot:
  • NP_055273(Human)