KLHL1 Antibody

Images

 
Immunohistochemistry-Paraffin: KLHL1 Antibody [NBP1-83551] - Staining of human testis shows distinct positivity in cells of the seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHEKGLVLQELKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KLHL1 Protein (NBP1-83551PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHL1 Antibody

  • FLJ30047
  • kelch (Drosophila)-like 1
  • kelch-like 1 (Drosophila)
  • KIAA1490kelch-like protein 1
  • Mayven-related protein 2
  • MRP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-46466
Species: Hu
Applications: IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83551
Species: Hu
Applications: IHC, IHC-P

Publications for KLHL1 Antibody (NBP1-83551) (0)

There are no publications for KLHL1 Antibody (NBP1-83551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL1 Antibody (NBP1-83551) (0)

There are no reviews for KLHL1 Antibody (NBP1-83551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KLHL1 Antibody (NBP1-83551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL1 Products

Bioinformatics Tool for KLHL1 Antibody (NBP1-83551)

Discover related pathways, diseases and genes to KLHL1 Antibody (NBP1-83551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL1 Antibody (NBP1-83551)

Discover more about diseases related to KLHL1 Antibody (NBP1-83551).
 

Pathways for KLHL1 Antibody (NBP1-83551)

View related products by pathway.

Blogs on KLHL1

There are no specific blogs for KLHL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL1