KLHDC2 Antibody - Azide and BSA Free

Western Blot: KLHDC2 Antibody [NBP3-04568] - Western blot analysis of extracts of K-562 cells, using KLHDC2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 150s.

Immunohistochemistry: KLHDC2 Antibody - Azide and BSA Free [KLHDC2] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using KLHDC2 Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry: KLHDC2 Antibody - Azide and BSA Free [KLHDC2] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using KLHDC2 Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KLHDC2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit KLHDC2 Antibody - Azide and BSA Free (NBP3-04568) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 306-406 of human KLHDC2 (NP_055130.1). EWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAHSNEILIFSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHDC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for KLHDC2 Antibody - Azide and BSA Free

• HCA33
• HCLP-1Host cell factor-like protein 1
• Hepatocellular carcinoma-associated antigen 33
• Host cell factor homolog LCP
• kelch domain containing 2
• kelch domain-containing protein 2
• KLHDC2
• LCP

Background

KLHDC2, also known as Kelch domain-containing protein 2, is a 46kDa 406 amino acid protein with a shorter 28kDa 249 isoform produced by alternative splicing. KLHDC2 interfers with CREB3-DNA binding by repressing CREB3-mediated transcription. Current research is being conducted on KLHDC2 in relation to Legg-Calve-Perthes disease, hepatocellular carcinoma and herpes simplex. KLHDC2 is linked to the reflex, excretion, micturition, cytokine production and lactation pathways where it interacts with DDX19B, SFN, STRN4, EZH2 and UBXN7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLHDC2